KEGG   Schizosaccharomyces pombe (fission yeast): SPAC26H5.08cHelp
Entry
SPAC26H5.08c      CDS       T00076                                 

Gene name
bgl2
Definition
(RefSeq) putative glucan beta-glucosidase Bgl2
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00500  Starch and sucrose metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPAC26H5.08c (bgl2)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     SPAC26H5.08c (bgl2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_17
Motif
Other DBs
NCBI-GeneID: 2542700
NCBI-ProteinID: NP_594455
PomBase: SPAC26H5.08c
UniProt: O13990
Position
I:complement(4134622..4135587)
Genome map
AA seq 321 aa AA seqDB search
MQFLSSFVFAALALLPLSAMAVDEAASEIASSTKPASTNGTLSFCLGVKHADGTCKYTDD
YLADFEVLAPYTNMIRTYATSDCNTLEYLLPALAQSPYNFSAILGVWPTDDAHYDLEKQA
LMQYLPQYGVDHVRAITVGSEVLYRNDLPADVLAERIYDVRGLVQQKLGFDVPVGTADSW
NLWAGGSGDVVITASDFIMSNDFPYWQGQNTSNMTNTFISDTLAALERVQSVKGTNNVTF
WVGETGWPTDGPSYGEADATVDIASEFFQEALCNIRRKGIDIFFFEAFDEDWKGDSSSVE
PYFGAMYSNRTLKYNLNCTSE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcctttcgtcttttgtgtttgccgctttggctttgttgcctctttctgctatg
gctgttgatgaagctgcttccgaaatcgcttcttccaccaagcctgcctctaccaatggc
actctcagcttctgcttaggcgtgaagcatgctgatggcacctgcaagtatacggacgat
tacttggctgattttgaggtccttgctccttacaccaacatgattcgtacctatgccact
agtgattgtaacactctcgagtacttattacccgcacttgctcagtcgccttacaacttt
tctgccatcctcggtgtttggcccactgacgacgctcattacgatttggaaaagcaagct
cttatgcagtatttgcctcagtatggtgttgatcatgttagagctataacagttggctct
gaagtcttgtacaggaatgatctacctgctgacgtccttgccgaacgcatttacgacgtc
cgtggccttgttcaacaaaagctcggcttcgatgttcccgttggtactgcggatagttgg
aacttgtgggctggtggtagcggtgatgttgttattactgccagtgactttatcatgtcg
aatgacttcccttactggcaaggtcaaaacaccagtaacatgaccaacaccttcatctcc
gatactttggctgctttagagcgcgtccaatccgtcaagggtaccaacaacgttaccttt
tgggttggtgagactggttggcctactgatggtccttcttatggagaggctgatgccacg
gttgatattgctagtgaattcttccaagaggccttgtgtaacatacgtcgtaagggcatt
gatatcttctttttcgaggcatttgacgaggactggaagggtgactcctcttccgttgaa
ccctactttggagccatgtacagcaaccgcactctcaagtacaatttgaattgcacctct
gagtaa

DBGET integrated database retrieval system