KEGG   Schizosaccharomyces pombe (fission yeast): SPAC27D7.05c
Entry
SPAC27D7.05c      CDS       T00076                                 

Gene name
apc14
Definition
(RefSeq) anaphase-promoting complex subunit Apc14
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Other DBs
NCBI-GeneID: 2542211
NCBI-ProteinID: NP_594611
PomBase: SPAC27D7.05c
UniProt: O42659
Position
I:complement(4517973..4518296)
AA seq 107 aa
MDPFAGTGQSKSYRTFGNVFQRLSMSGNPKPLAKKPLLLPEASKAIEFWNYRDVIGGEEA
EQERNERASRIAISRIASSRSSIPEYRQAIMQHLTKHVQQLDQLAEW
NT seq 324 nt   +upstreamnt  +downstreamnt
atggatccgtttgctggtactggtcagtccaaaagttatcgaacttttggaaacgtcttt
caaagactctccatgtctggcaacccaaaacctctcgccaagaaaccacttctactccct
gaagcttcaaaagccattgaattttggaattatcgagatgttataggtggtgaagaggcc
gagcaagaaagaaatgaaagggcaagtagaattgcaatatccagaattgcttccagcaga
agttctattccagaatacaggcaagctattatgcagcatctgacaaaacatgttcaacaa
cttgaccagttggctgaatggtga

DBGET integrated database retrieval system