KEGG   Schizosaccharomyces pombe (fission yeast): SPAC27D7.09c
Entry
SPAC27D7.09c      CDS       T00076                                 

Definition
(RefSeq) But2 family protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: But2 ApbA
Other DBs
NCBI-GeneID: 2542693
NCBI-ProteinID: NP_594615
PomBase: SPAC27D7.09c
UniProt: O42663
Position
I:complement(4523388..4524539)
AA seq 383 aa
MKLTSIPIASTLLSLLAASGTLASPLHKRDDPLNNKQFGLMSIHSGNSYVHLHPFYVGDS
GAIYLDPTDGTSTSAVFSMSNGRLVVGNLYASVDSNGTTIFKSDANAASTKFSAGDATNV
GYNLLYNGTQSAVACPASDNDQVYQVYFGAGNGNPNCAGIAIEAFVSPSSSSSSSSSAAT
STSTRVSSSAKASTSSGAIAYTTKCVVVPVTASATATAKAASAAASSAVYPLFPHGIRLI
DSANPSSNSGNVYSPVVFQKQNNHTNTIFTFDVPQVSGSCELNLHLDTSGFPITVEGSNG
VGQFILFNLSSVANDSTVYSNRPNRIAEIGRFNCSSSGCDYATNVTCPNSYTAVSYEMMA
LTDDSYLSFFEEADPLEGLTLRV
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgaagcttacttcaatccccattgcttccacattgctctctttgctcgctgcctcgggc
acattagcttcaccgttgcataagcgtgatgaccctttgaacaacaagcaatttggccta
atgtctattcattctggcaacagttatgtccacttgcaccctttctatgtaggagactct
ggcgctatttacctggatcctactgatggtaccagtactagtgctgtcttttctatgagt
aacggaagactggttgtcggaaatctttacgcttcggttgacagcaatggcaccactatt
ttcaaatctgatgctaatgcagcttccactaagttcagtgctggtgatgctactaatgtt
ggatacaatcttctatataatggaacccaatctgcggtagcttgtcctgctagtgataat
gatcaggtctaccaagtatacttcggagccggaaatggtaaccccaattgtgcaggtatt
gctattgaggccttcgtgtctccatcctcttcttcttcttcttctagttcagctgctact
tcaacttcaactcgcgtttcatcgtctgctaaagcaagcacttctagtggggcaattgct
tacaccaccaaatgtgttgttgttcctgttacagcatcggctactgccacggcaaaagct
gcatccgcagcagcttcctcagctgtttaccctcttttcccacatggaattcgtttgatc
gattctgctaaccccagttccaactccggtaatgtttactctccagtcgtctttcagaag
caaaacaatcataccaacacgattttcacatttgatgttcctcaagtttccggcagttgc
gaactcaacctacatctcgatactagcggtttcccaatcactgttgaaggcagcaatggt
gttggtcaattcattcttttcaacctctcctccgtcgccaacgattctactgtttactcc
aaccgtccaaaccgcattgccgaaattggacgtttcaactgctctagctctggttgcgat
tatgctaccaacgttacatgccccaactcatacaccgcggtttcttatgaaatgatggct
ctcactgatgactcttatttgagtttcttcgaagaagccgatcctcttgagggattaact
ttacgagtttaa

DBGET integrated database retrieval system