KEGG   Schizosaccharomyces pombe (fission yeast): SPAC27E2.05
Entry
SPAC27E2.05       CDS       T00076                                 
Symbol
cdc1
Name
(RefSeq) DNA polymerase delta small subunit Cdc1
  KO
K02328  DNA polymerase delta subunit 2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03410  Base excision repair
spo03420  Nucleotide excision repair
spo03430  Mismatch repair
spo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPAC27E2.05 (cdc1)
   03410 Base excision repair
    SPAC27E2.05 (cdc1)
   03420 Nucleotide excision repair
    SPAC27E2.05 (cdc1)
   03430 Mismatch repair
    SPAC27E2.05 (cdc1)
   03440 Homologous recombination
    SPAC27E2.05 (cdc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPAC27E2.05 (cdc1)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC27E2.05 (cdc1)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    SPAC27E2.05 (cdc1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      SPAC27E2.05 (cdc1)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     SPAC27E2.05 (cdc1)
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Other DBs
NCBI-GeneID: 2542083
NCBI-ProteinID: NP_594406
PomBase: SPAC27E2.05
UniProt: P87324
Position
I:<4015050..4016557
AA seq 462 aa
MVEVRHSIPCEETKRLELSLSQQTYSQQYASIYFARLTALRPRITEAASKKWPDKQRLER
VLDVKSDEDCWVVATAYMTTALKPNVMNDVTQLHTIVTTTEESPYVSPEDAASGDIEYAL
EDDYGRIDCSGSFLYDAGVVTGVVLAVLGHEDEQGRFVVVDVCFPGIFSHSIPMTTDESQ
AQPEYIAAVSGLGLSNDGIEGIQVHQLVDFLRGTLPHVSSFSPSSIKRLIILGNCLAPSI
EIADSASASVPIGKKKVKRYGYDTSAYNPNPTFQLDNFLDQVCSSIDVTLMPGPYDYSST
ILPQQPLHPALLTKSKVWLGSSLQTVTNPTWLSLGNHFVLATSGQNINDLRKYHPKKSSL
QCMENTLLWNHITPTSPDTLWCYPFTDKDTFVMEEMPDLYLCGNQPKFGCKTVINEGNRI
QLVSVPEFRKTGVLVLINMHTLNVEIIQFRPMSVKAETPITS
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggttgaagtcagacattcaattccttgtgaagaaactaaacgcttggagcttagttta
agtcagcaaacgtatagtcaacagtacgccagcatctatttcgcccgacttaccgctctt
cgacccagaatcacagaagccgcttcaaaaaaatggccggataaacagcgattggaacgc
gttttagatgttaagtcagatgaagactgttgggttgtcgctaccgcttatatgactaca
gctcttaagccaaacgttatgaacgatgtcacacaacttcatacaattgtcaccactact
gaagaatctccgtatgttagcccagaagatgctgcttcaggtgatatagaatatgctctt
gaggatgactatggccgtatagattgtagcggaagctttttgtatgacgctggcgttgtt
acaggagttgttcttgcagttttgggccatgaagatgaacaaggtcgtttcgttgtcgtt
gacgtttgttttccaggcatcttctctcattccattccaatgactacagatgaatcgcaa
gctcaaccagagtacattgcggcagtcagtggcttaggtctctcaaatgacggcatagaa
ggcattcaagttcatcagcttgtagatttcctaagaggaacacttccacatgtctcttcc
ttttccccttcctccatcaaaaggctaattattctcggaaattgcttagcaccttctata
gaaattgccgactccgcttctgcgtccgtgcccattggcaagaaaaaagtaaaaagatat
ggctatgacacgtctgcttacaatccaaatcccaccttccaactagataattttcttgat
caagtgtgttccagcatagatgtcactttaatgcctggtccttatgattacagttcaact
atccttcctcaacagcctttgcatcccgctttacttactaaatcaaaagtttggttggga
tcttctttacaaacagttacgaatcccacttggctttctcttggcaatcattttgtgttg
gctactagcggccaaaacattaatgatctccgaaaatatcatcccaaaaaatcttcactt
caatgcatggaaaacactttactatggaatcatatcacacctaccagccctgatacctta
tggtgctatcctttcaccgacaaagatacatttgtaatggaggaaatgcctgatctatat
ctttgtggtaatcaaccgaaatttggctgcaaaacagtcattaatgagggaaacagaata
caattggtttccgttcccgaatttcgtaagactggtgtacttgttctcataaatatgcat
acgctcaacgtagaaattattcaattccgccccatgtcagtcaaagcagagactccaatt
acttcttaa

DBGET integrated database retrieval system