KEGG   Schizosaccharomyces pombe (fission yeast): SPAC29A4.15
Entry
SPAC29A4.15       CDS       T00076                                 

Definition
(RefSeq) putative serine--tRNA (Ser) ligase Srs1
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPAC29A4.15
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPAC29A4.15
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPAC29A4.15
Enzymes [BR:spo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     SPAC29A4.15
Amino acid related enzymes [BR:spo01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   SPAC29A4.15
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SPAC29A4.15
 Prokaryotic type
    SPAC29A4.15
SSDB
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N GCR1_C GED
Other DBs
NCBI-GeneID: 2542163
NCBI-ProteinID: NP_594867
PomBase: SPAC29A4.15
UniProt: O14018
Position
I:complement(5117526..5118878)
AA seq 450 aa
MLDINLFQVEKGGNPEIIRESQRKRGADVGVVDKVIEMYKEWVSLRFELDNTNKSINRVQ
KEIGLKMKAKEDASELLEEKNSLTERKKNLIEQETAKNKEMLNVVSSIGNIVHDSVPVSM
DEDNNEIIRKWAPEGVTVEKKNCLSHHEVLTRLDGYDPERGVKVSGHRGYFLRQYGVFFN
LALIQYGLDFLEKRGYIALQAPTMLNKDVMAKTAQLEQFDEELYKVIDGDEERYLIATSE
QPISAYHSGEWFEKPSEQLPLKYAGYSTCYRREAGSHGRDAWGIFRVHAFEKIEQFVLTD
PEKSWEAFTEMINHAEDFYKSLELPYRIVAIVSGALNNAAAKKYDLEAWFPFQGEYKELV
SCSNCTDYQSRNLEIRCGVKKMGDREKKYVHCLNSTLCATERALCCILENYQTPDGVNVP
KVLQPYMGGKTFLPFTKELPKNSTSKKGKN
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgttagacataaacttgtttcaggttgaaaagggtggaaaccccgaaattatccgcgaa
tcacagcgcaaacgtggagccgatgtcggcgttgttgataaagttatcgaaatgtacaaa
gaatgggtttctcttcgattcgaactcgacaacactaacaagtcgatcaatcgagttcaa
aaagaaattggcttaaaaatgaaggctaaggaagatgcttctgaattgttggaggaaaaa
aattctctcaccgaacgtaagaagaaccttatcgagcaagaaacagccaagaataaagag
atgctcaacgtagtctcttccatcggcaacattgtacatgattctgtaccagttagcatg
gacgaagacaacaatgagattattcgtaagtgggctcccgaaggtgttactgtggagaag
aagaattgtttgtcccatcatgaagttttaactagattggacgggtatgatcctgaacgt
ggtgttaaggtgtctggtcatagaggatactttttgcgtcagtatggtgtctttttcaat
ctcgccctaattcaatatggtcttgactttttagagaaacgtggatatattgcgttgcaa
gcgcctaccatgttgaacaaagatgtcatggctaagactgctcagttagagcaattcgat
gaagagctttacaaagtaattgatggtgatgaggaacgctatttgatcgctacctccgaa
caacctatttctgcctaccatagcggtgaatggtttgaaaagccttctgaacagctccct
cttaagtacgctggatacagtacttgttatcgtcgtgaagcagggtcccatggacgtgat
gcttggggtattttccgcgttcatgccttcgagaagattgaacaatttgttcttaccgat
cctgaaaagtcatgggaagctttcaccgagatgatcaaccatgctgaggacttttataag
tctttagaattgccttatcgtatcgttgccattgtttctggtgctttgaacaatgctgct
gccaagaagtatgatttggaagcttggttccctttccaaggagaatacaaagagcttgtt
tcttgctcaaactgtaccgattatcaatctcgtaacttggagattcgttgtggtgtaaag
aagatgggcgatcgtgaaaagaagtatgttcactgccttaactctactctctgtgctact
gagcgggcactttgctgtatacttgaaaactaccaaactcctgatggtgtaaatgtacct
aaggtgttgcaaccttatatgggaggtaaaactttccttccattcaccaaggaattaccc
aaaaattctacctccaagaagggaaagaattaa

DBGET integrated database retrieval system