KEGG   Schizosaccharomyces pombe (fission yeast): SPAC29A4.16
Entry
SPAC29A4.16       CDS       T00076                                 

Gene name
hal4
Definition
(RefSeq) halotolerence protein 4
  KO
K08286  protein-serine/threonine kinase [EC:2.7.11.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPAC29A4.16 (hal4)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     SPAC29A4.16 (hal4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo
Other DBs
NCBI-GeneID: 2542804
NCBI-ProteinID: NP_594866
PomBase: SPAC29A4.16
UniProt: O14019
Position
I:complement(5114504..5116414)
AA seq 636 aa
MGEKDKLHEISSKFASLGLGSLKSTPKARETTEPPPPSSQQPPSTPNGKEAASPSALKQN
VRPSLNSVQQTPASIDAVASSSNVSLQSQQPLSKPVVSSKPNQTTAMPPPSNNPSRHVSS
TSNKPAAVSPNPAAHHAELPSGSVPPSASVSRANSTATTTPHKAGVVSNPAAANVHVLSV
AASPNPSTPSNGPAPVSTTATPSRNPVTRLQRIFSQNSVSRQNSRTGRGAAVANTEETNS
TGGSETGGAANSSSTSNPSSAKWSRFTVYDDASHTHQLRPARRQEKLGKMLKDFLAGNSK
KREEERIAKEAADAQHQLSLVQSWINGYGQEKLADKKDPAKVSASFVEKYGRCQEVIGRG
AFGVVRIAHKVDPQNSGSETLYAVKEFRRKPAESQKKYTKRLTSEFCISSSLRHPNVIHT
LDLIQDGKGDYCEVMELCSGGDLYTLIMAAGRLEPMEADCFFKQLMRGVDYLHDMGVAHR
DLKPENLLLTVSGSLKITDFGNGECFRMAWEKEAHMTCGLCGSAPYIAPEEYTESEFDPR
AVDVWACGVIYMAMRTGRHLWRVAKKSEDEYYSRYLMDRKNESGYEPIEMLERSRCRNTL
YNILHPNPTYRLTAKQIMKSEWVRSITLCEAGNAGL
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgggtgaaaaagacaaactccacgaaatttcaagcaaatttgcttccttagggcttggg
tcgctgaagtcaacccctaaagctcgtgaaacgacagaacctcctccgccatcatctcag
caacctccaagcactccaaatggcaaagaagctgcttctccaagtgctttaaaacaaaat
gtccgtccttcccttaactctgtgcagcaaactcctgcatcgatagatgcagtggcctct
tcttccaatgtaagcctgcaatctcagcagcccttatctaaacctgtcgtttcatccaaa
cctaatcaaaccactgcaatgccacctcctagcaataacccatctcgccatgttagctct
acttcaaacaaaccagcagccgtctctcctaatccagcagcgcaccatgcagagttgccc
tctgggtccgttcctccttcagcttctgtatcccgagcaaactcaactgctaccactaca
cctcacaaagctggtgtcgtctctaatccagcggcagctaacgttcacgtactatctgta
gctgcctctcctaatccttctacgccttccaacggcccagcacctgtttccactacagca
acaccatctagaaatccagtcactcgtcttcaacgtattttttcacaaaactctgtatct
cgccaaaacagtcgaactggtcgaggcgcagctgttgcaaatactgaggaaacgaatagc
acaggtggtagtgaaacaggtggtgctgctaatagttcatctacttcaaatccttcctct
gcgaagtggtctcgctttactgtttatgacgatgcaagtcatacgcatcaattaaggcct
gctcgtcggcaagagaagcttggtaagatgttaaaagacttccttgccggtaacagtaaa
aagcgtgaggaagagaggatagctaaagaagctgctgatgcacagcatcaactcagtctt
gttcaatcatggatcaacggatatggtcaagaaaagcttgctgacaaaaaagatcccgct
aaagtttctgcaagttttgtagagaaatatggtcgctgtcaggaggttattggtcgtggc
gcttttggcgttgttagaatcgcacataaagttgatcctcaaaactccggctctgagaca
ttgtatgccgttaaggagttccgtcgaaagcctgccgagtctcaaaagaagtatacaaag
cgcttaacatctgagttttgtatttcttcttcattgcgacatccaaacgtgattcataca
ttagacctgatccaggacggcaagggtgactattgtgaagtgatggagctttgttcggga
ggcgatttgtatacgcttatcatggccgccggtcgtctagagcctatggaagctgattgt
tttttcaaacaattgatgcgtggtgttgattatttgcatgatatgggtgtggctcatcgt
gatttaaagccggaaaatttgttattgaccgttagcggaagtctaaaaatcactgatttc
ggtaatggtgaatgctttagaatggcctgggagaaggaggctcacatgacatgcggcctc
tgtggatccgcaccctacattgctccagaagaatatacagaaagtgaatttgatccacgc
gcagtagatgtctgggcttgtggtgttatctatatggccatgcgtaccggtcgacatctt
tggcgcgttgccaaaaagagtgaagacgagtattactccagatatctgatggataggaaa
aacgagagcggttatgaacctatcgaaatgcttgaacgttcaagatgcagaaacactttg
tacaacattcttcatcccaacccaacttaccgcctgacagcaaaacagataatgaagagt
gaatgggttcgttccatcactctttgtgaagctggcaatgctggtctgtaa

DBGET integrated database retrieval system