KEGG   Schizosaccharomyces pombe (fission yeast): SPAC29A4.18
Entry
SPAC29A4.18       CDS       T00076                                 

Gene name
prw1
Definition
(RefSeq) Clr6 histone deacetylase complex subunit Prw1
  KO
K10752  histone-binding protein RBBP4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC29A4.18 (prw1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    CAF-1
     SPAC29A4.18 (prw1)
  Histone modification proteins
   HAT complexes
    HATB complex
     SPAC29A4.18 (prw1)
   HDAC complexes
    Sin3A-HDAC complex
     SPAC29A4.18 (prw1)
   Polycomb group proteins
    PRC2-EZH1 complex
     SPAC29A4.18 (prw1)
    PRC2-EZH2 complex
     SPAC29A4.18 (prw1)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    MIS16-MIS18 complex
     SPAC29A4.18 (prw1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    SPAC29A4.18 (prw1)
  Chromatin remodeling factors
   NuRD complex
    SPAC29A4.18 (prw1)
   NuRF complex
    SPAC29A4.18 (prw1)
   NuRF complex (fruit fly)
    SPAC29A4.18 (prw1)
SSDB
Motif
Pfam: WD40 CAF1C_H4-bd
Other DBs
NCBI-GeneID: 2541804
NCBI-ProteinID: NP_594864
PomBase: SPAC29A4.18
UniProt: O14021
Position
I:complement(join(5110432..5111536,5111614..5111719,5111790..5111874))
AA seq 431 aa
MAVSAVPHPSKQAQASEEGINQEKCINEEYKIWKKNSPFLYDLIITRALEWPCMSLQWYP
EQQIFAEHGYTEQKMFLGVRADVGKYLLAVASIQLPYLNQTVPPTTMEGASAGDESSLRV
NISNLYSHPESVCSAKLMPQDDSCVATVGNYHNDVLVFDKESFESYSSASESPLKPKYRL
TKHTQPCTSVCWNFLSKGTLVSGSQDATLSCWDLNAYNESDSASVLKVHISSHEKQVSDV
RFHYKHQDLLASVSYDQYLHVHDIRRPDASTKPARSVHAHSGPIHSVAFNPHNDFILATC
STDKTIALWDLRNLNQRLHTLEGHEDIVTKISFSPHEEPILASTSADRRTLVWDLSRIGE
DQPAEEAQDGPPELLFMHGGHTSCTIDMDWCPNYNWTMATAAEDNILQIWTPSRSIWGNE
QLEEDATAYLS
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggctgtatcagctgttccccatccttccaagcaagcgcaggcttcggaggagggaata
aatcaagaaaaatgcatcaatgaagagtataaaatttggaaaaagaactcaccgttcctt
tacgatttaataattactagagctttggaatggccttgtatgtcactacaatggtatcca
gagcagcaaatttttgcagaacatggatatactgagcagaaaatgtttctgggagttcgt
gctgatgttggcaaatacttactagctgttgcgtctattcaattaccctatttaaatcag
actgttcctcctactacaatggagggagcatctgcgggtgacgagtcttctctacgtgtt
aatatctcaaatctttattctcatcctgagtctgtttgtagtgcgaagcttatgccacaa
gacgattcttgtgtagctacggtgggtaactatcataatgatgtgttggtttttgacaag
gaatccttcgaatcttatagctcggctagtgagtctcctcttaagcccaaatatagattg
accaaacatacccagccctgtactagtgtttgttggaattttctttctaagggtactttg
gtttctggatcgcaagacgctactctttcttgttgggatttgaatgcttacaacgagtca
gattcagcgtcagttttgaaagtgcatataagcagccatgaaaaacaggtcagtgatgta
cgctttcattataagcaccaggatcttcttgcttcagtttcctatgatcagtaccttcat
gttcatgatattcgtcgccctgatgcttccacaaagccagctcgaagtgtgcatgcccat
agcggtcctattcattctgttgctttcaaccctcataacgactttattttggctacttgt
tcgactgacaaaaccattgcactttgggatttacggaaccttaatcaacgcttacataca
ttagaaggacatgaagacattgtaacaaaaattagcttttctcctcatgaagagcctatt
cttgcttctacctcagccgatagaaggaccttagtttgggatctttcaagaatcggggaa
gatcagcctgctgaggaagctcaagacggtcctccggagcttctttttatgcacggaggc
catacttcttgtacaattgacatggattggtgtcctaattataattggacaatggcaacc
gctgctgaagataatattcttcaaatttggacaccttctcgctcaatttggggtaatgaa
caattagaggaagatgctacggcatatttaagttaa

DBGET integrated database retrieval system