KEGG   Schizosaccharomyces pombe (fission yeast): SPAC29B12.10c
Entry
SPAC29B12.10c     CDS       T00076                                 

Gene name
pgt1
Definition
(RefSeq) glutathione transporter Pgt1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: OPT
Other DBs
NCBI-GeneID: 2542082
NCBI-ProteinID: NP_594987
PomBase: SPAC29B12.10c
UniProt: O14031
Position
I:complement(5431858..5434413)
AA seq 851 aa
MTARNSASIPTSIRKTSENEVSGDETPAGVGNLSTKTASKTSLTFRQSSSDESTSSYSGN
HHNINIQHHPNRPFRTNSSSFSPNDYSISESPSKSKKDGVHVSAVQLDNETDSEVESEVE
ELERELEAIEDSVYPEVRAAVNPTDDVNLPVNTWRTWVLTTIFVIVFAAVNQFFSLRYPA
LSISFIVAQLILFPLGKLLNLLPNWKIGYGRFSFYLNSSPFNVKEHAAITIAVSLTSSTA
YATNILSAQTSFYKQNLSWGYKILIVLTSQMLGYGFAGLTRRWIVYPAAMIWPQTLVSTV
LFRTLHGNSGNDIGVLKNNRISANGWTISRYRFFAYVMIGSFVFYWFPGFIFKGLSYFTV
LCWIWPKNRVVNQLFGYNSGLGILPLTFDWQQVVYNSNPLASPWWVICNTFGSVVLIFWI
VVPILYYKGVWFSNYLPMLSSSTFDHTGVSYNSSRVLNSDYSFNHTKYESYSPLYMPMSY
SMSTALNFAAVTAIFTHCALYNGKDIWQRLWKESGKDECIHRKLMRNYKEAPQWWYATLF
IVVFGLTIFTVRYYDTQCPVWALIVALLIFIVNFIPQGVLEGITNQHVGLNIITELIGGY
ILPGKPLANLMIKLYGFIPMRQGLEFSRDLKLAQYMKIPPRILFFVQLFATILGGITQVA
VQEWMNYHIPGICTTSQSNGFTCPNGRSIYNASLIWGAIGPAKMFSKGKPYYPLIFFFLI
GAVAPFITWGLRKRFPKSWIGKLNAPVLFTGPGNIPPATGINYSSWAIVGFIFNYVIRKR
AIHWWRKYNYVLAAAMDSGVAVAGVVIFLCVSYPGGKITWWGNTVYTKTYDWKSVPYRSL
GPNETFGYTNW
NT seq 2556 nt   +upstreamnt  +downstreamnt
atgacagctcgcaattctgctagtattcctaccagtattaggaaaacatctgaaaatgaa
gtctctggagatgagacaccagctggagttgggaatttatctacaaagacggcctctaag
acttcgctgacttttcgacagtcttcttctgacgagtcgacgagcagttatagtggaaac
caccataatattaacattcaacatcaccctaatcgtccttttcggaccaattcatcttca
ttcagtccaaatgactacagcataagtgaaagtcctagtaaatcgaagaaggatggcgtg
catgtctcagcggttcaacttgacaatgaaaccgactctgaagtcgagtcagaagtagaa
gagttggaacgtgaattagaagccattgaagattctgtttacccagaagttcgtgctgcc
gtaaatcctactgacgacgttaatttgcctgtgaacacttggagaacttgggtgcttacc
accatatttgtaatagttttcgctgctgtgaatcaattttttagtctacgttatccggct
ttgagcatcagtttcattgtcgctcaattaattttatttcctctaggaaaactattgaac
ttgttaccaaattggaagattggttatggtcgattctctttttatcttaattcttccccc
tttaacgttaaagaacatgcagccattacaatcgctgtttccctaacatcatctaccgct
tatgccacgaatatcctgtccgcccaaactagcttctataaacaaaacctctcgtggggt
tataaaatacttattgtgcttacctcgcaaatgctgggttatggatttgccggtctcact
agacgctggattgtgtatccagctgctatgatctggcctcaaactttagtaagcactgtt
ctgtttagaacacttcacggtaatagtggaaatgacattggggtattaaaaaataacagg
atatctgctaatggctggaccatttccagatatcgcttttttgcatatgtaatgattgga
tcatttgttttttactggtttcctgggttcatatttaaaggtctttcttattttaccgtt
ctttgctggatatggccaaagaatcgtgttgtaaatcagttatttggatacaactccggt
cttggcattcttccccttacattcgactggcagcaagtcgtttacaacagcaatccattg
gcttctccctggtgggtaatttgcaatacttttggatcggtggttttaattttttggatt
gtcgttcctatcttgtactataaaggtgtttggttctctaattatttacccatgctttca
tcttcaacatttgatcacaccggtgtaagctacaactcttcacgtgttcttaatagtgat
tactcatttaatcatacaaaatatgaatcatattcacccttatatatgcctatgtcctat
agcatgtcaactgctttgaattttgctgctgtgacagctattttcacacattgcgcttta
tacaatggaaaagatatatggcaacgcttatggaaagagtctggtaaagatgaatgcatt
catcggaagctgatgcgcaattataaggaagcacctcagtggtggtatgccacattgttc
atcgtagtctttggcttaaccattttcacagttcgttactatgatacgcaatgtcctgtg
tgggctctcattgttgccttgttgatttttattgtaaatttcattcctcaaggtgttctt
gaaggcattacaaatcagcatgtcggtctcaatattatcactgagctaattggcggttat
attttacctgggaaacctttagctaatttgatgattaaactgtatgggttcattcctatg
cggcaagggctagagttttctcgtgatcttaaactcgctcaatatatgaaaatacctcca
cgtatattattttttgttcagctttttgctacaatcctcggtggaattacccaggttgct
gtacaggaatggatgaattatcacattccaggtatttgtacaacttcacaatcaaatggc
tttacttgtcccaacggtcgttccatctataatgcctccttaatttggggtgcaattggg
cccgctaaaatgttttcaaaaggaaaaccatattacccattgatttttttctttttgata
ggtgcagttgctccttttataacatggggtttgagaaaaaggtttcctaagtcgtggatt
ggaaagcttaatgctccggtccttttcactggtcctggcaatattcctcccgctactgga
attaactattcttcttgggcaattgttgggtttatatttaattatgtgattagaaagcgc
gcgatacactggtggaggaagtacaactacgtactggctgcagctatggattctggggtt
gcagtcgctggagtagtaattttcttatgtgtatcataccctggaggtaagataacctgg
tggggaaacactgtgtacactaaaacttatgattggaaaagtgtgccatataggtcactt
gggccaaacgaaacctttggttacaccaattggtaa

DBGET integrated database retrieval system