KEGG   Schizosaccharomyces pombe (fission yeast): SPAC29B12.13
Entry
SPAC29B12.13      CDS       T00076                                 
Name
(RefSeq) S-(hydroxymethyl)glutathione synthase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: GFA Zn_ribbon_recom
Other DBs
NCBI-GeneID: 2542706
NCBI-ProteinID: NP_594990
PomBase: SPAC29B12.13
Ensembl: SPAC29B12.13
UniProt: O14034
Position
I:5438983..5439489
AA seq 137 aa
MPEYEGNCLCKAIHLKAIIEEPKLSCCHCETCRIWCSSPFMAFSCTQKPSVSENENVGKY
ASSSFAERIFCKNCGTTLYFAYTNGKNPYFINAWLFKGIENITFDAQVCIDDKPDCYDFA
NKTSMFTVDEVMKSIVK
NT seq 414 nt   +upstreamnt  +downstreamnt
atgcctgaatacgaaggcaactgtttgtgcaaagctattcacctaaaggcaataattgaa
gaacctaaacttagttgttgtcattgtgaaacttgcagaatatggtgttccagtccattt
atggcattttcttgtactcaaaaacccagtgtctctgaaaatgagaatgtaggtaaatac
gcttcatcttcatttgctgaaagaattttctgtaaaaattgtggtactacattatatttc
gcttatacaaatggtaagaatccgtactttataaatgcttggctcttcaagggaatagaa
aatatcacttttgacgcacaagtttgtatagacgacaaaccagattgttatgactttgcc
aacaagacgtctatgtttacagtagatgaagtgatgaaatccatagtaaaataa

DBGET integrated database retrieval system