KEGG   Schizosaccharomyces pombe (fission yeast): SPAC29E6.06cHelp
Entry
SPAC29E6.06c      CDS       T00076                                 

Definition
(RefSeq) putative cysteine--tRNA(Cys) ligase Crs1
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPAC29E6.06c
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPAC29E6.06c
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPAC29E6.06c
Enzymes [BR:spo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     SPAC29E6.06c
Amino acid related enzymes [BR:spo01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   SPAC29E6.06c
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SPAC29E6.06c
 Prokaryotic type
    SPAC29E6.06c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f tRNA-synt_1c DALR_2
Motif
Other DBs
NCBI-GeneID: 2542721
NCBI-ProteinID: NP_594564
PomBase: SPAC29E6.06c
UniProt: Q09860
Position
I:complement(4411655..4413919)
Genome map
AA seq 754 aa AA seqDB search
MSTRNPAQSHWGVPKGQRTELYVYNTLTHSKVPFVSNGSNLTWYCCGPTVYDASHMGHAR
NYVTTDILRRILQSYFGYNITFVQNVTDIDDKIILRARQQYLFEEYKKQQGTNKSHSEAR
EKVTEAWFAYAKKNLPEPPSSMSEWPQWLASHDIPTLAINNPKLPMHVDALKSALDALQV
SEASEIISLDGFWPKVQDVLVPLLDAELGSTVTDPAIFRKLAAYWEDDFNKDMANLNVLP
PTAVTRVSEYVPEIVDFVQRIIDRGYAYPVTDGSVYFDTEAFEKGGHFYAKLEPWNKGNR
ELIAEGEGSLAALTGKKRPGDFALWKASKPGEPSWDSPWSKGRPGWHIECSVMASALLGS
NIDIHSGGIDLAFPHHDNELAQSEAYFDCPQWVNYFFHAGHLHIEGQKMSKSLKNFITIK
EILKKFTPRQLRLAFLLQQWNTQLDFKETLLAYVLNIEQALENFFRTVRALMNETEGVSA
NGGHVPEKFDKLEIELLEKFQQTQQNTHLALCDSFNTPLVMQHIDNLVTQANIYIREVGQ
QPCSRLLGQIASWITSMLQIFGLDENGHPNAVGWSSSKGSSSENTDAMPYIRAVSSFRDR
VRELCIAKASSQEILKACDIFRDYDMAALGVSFNDRPQGSALVKLVDAEELIAAREQKLE
EERAKQAKKAQAKAEQEKKQVERVMKGKTSPSEMFKMFKEYLSFDEAGLPTKMRGEDGSE
IDVPKSRKKKLQKEYAQQEKLHKEYLSYIESNKS
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactagaaatcccgctcaatcgcattggggtgttcctaaaggacaaagaacggag
ctctatgtatacaacaccttaactcatagcaaggtgccttttgtttcaaatggttccaac
ttaacatggtactgctgtggacctacggtatatgatgctagtcatatggggcatgctcgt
aattatgtgacaactgatatccttcgaagaatcttacaatcttattttggatataacatt
acatttgtacaaaacgttactgatatagatgacaaaattatccttagagctcgtcaacaa
tatttatttgaagaatataaaaagcagcaaggtactaacaaatcccattcagaagctcgt
gaaaaggttactgaggcttggtttgcatatgccaagaaaaatcttcctgaacctccctcc
tcgatgagtgaatggcctcaatggctcgcatcccatgatattcccactttagctatcaac
aatcccaagttacccatgcatgtggatgctttaaagtctgctttggacgctcttcaggtg
agtgaagcttctgaaatcatttctttggatgggttttggcccaaggtacaagatgttttg
gtcccattgcttgatgcagaattgggtagcaccgtgactgatcctgcaatctttcgtaaa
cttgcagcttattgggaagatgacttcaacaaggacatggctaatctgaatgtcttgcca
cctactgctgttacgcgagtttcggaatatgttcctgaaatcgtagattttgttcagcgc
attatcgatcgcggttatgcttatccagttacagacggtagcgtttacttcgacacagag
gctttcgaaaaaggtggtcatttttatgctaaattggagccctggaataaaggaaatcga
gagttaattgctgagggcgagggttccttggctgctctcaccggtaaaaagcgtccggga
gactttgcgctttggaaggccagtaaacctggtgaaccctcttgggatagtccttggtcc
aaaggacgtcctggttggcatatcgaatgttctgtcatggctagcgctctacttggttcc
aatattgatattcactctggtggaattgatttggcattccctcatcacgataatgagttg
gcacaaagtgaggcctattttgactgtccccaatgggtgaattatttctttcatgcaggt
catttgcatattgaaggccagaaaatgtctaaatctcttaaaaattttatcactattaaa
gaaattttaaagaagtttacacctagacaattacgcttggcattcttacttcaacaatgg
aacactcaactcgattttaaggagacccttttggcatatgtcttaaacattgaacaagcc
ttagagaatttcttccggactgttagagctctcatgaatgaaactgaaggtgtaagcgct
aatgggggtcacgtacctgaaaaatttgataagctagaaattgagttacttgaaaaattc
caacaaactcagcaaaatacccatcttgctctttgtgatagttttaatactcctttggtc
atgcaacacattgataatttggttactcaagccaacatttatattcgtgaagttggtcaa
caaccttgctcacgtttacttggacaaattgcatcatggatcacttcgatgctccaaatt
tttggcctcgatgaaaacggccaccccaacgctgttggatggtcatcatcgaaaggaagt
tcttcggagaacactgatgccatgccatacattagggctgtatcttcattccgcgatcgt
gtaagggagctttgcattgctaaagcttcttctcaggagattctcaaagcttgtgatata
tttagagactatgatatggctgcacttggtgttagttttaatgatcgtccccaaggttct
gcacttgtcaaacttgttgatgctgaagagttaattgctgctagggagcaaaagcttgaa
gaggagagagctaagcaagctaagaaagcacaagcaaaagccgaacaggaaaagaagcaa
gtggaacgtgttatgaagggaaagacatcaccatcagagatgtttaaaatgttcaaagaa
tacctttcattcgatgaagcgggtttacctacaaaaatgcgcggcgaagacggctcggaa
atagacgttcccaaaagccgtaagaaaaaattgcaaaaagaatacgctcaacaagaaaaa
ttacataaggagtatttgtcgtatattgaatctaacaaatcttga

DBGET integrated database retrieval system