KEGG   Schizosaccharomyces pombe (fission yeast): SPAC29E6.10c
Entry
SPAC29E6.10c      CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: NST1
Other DBs
NCBI-GeneID: 2542488
NCBI-ProteinID: NP_594568
PomBase: SPAC29E6.10c
UniProt: Q09863
Position
I:complement(4418954..4422211)
AA seq 1085 aa
MNDKALRTEALSVGLEPPSFKDLLIPIPNSGTKKKNKKKKKPKAKKNVETQANVDLLGSA
GTDSAVTDVGANNGVIDHQASLELSNLNSRISHPQLVSANGDDSSLINVEGISSTDWQFT
LESDDTIEHSPQCILSTSSFVDEAEFPVHIPGLEDATSSNMSPNSVQNNMNLNTVALGSS
TSSKRKKKKKKKSKANSASLNVDDQRDFEQVYSTDVAITYRNGQALSYYNGSVRQASMNN
NVNNNKSKDIWSSSNTEEREQIREFWLSLSESERRSLVKVEKEAVLQKMKEQQKYSCSCS
VCGRKRLAIEEELEVLYDAYYEELEQYANIQRNLANTESVNASDEGSDKSQKGIISDSPK
LLSIPLNNVPSKSLNDDITQDELNSSNADVDEEVIETTSLEEKNVDNQEFVTSISNGNQT
LEDTSHSPQTQPPFQPPYPSKADEKNSYHSDLYNFGSSLTVKGGILTVADDLLKNDGKKF
IEMMEQLAERRMQREDNSNFHEPELYESGLEYDEDEEEDEEDVDEDELDLMTDEQRMEEG
RRMFQIFAARLFEQRVLQAYREKVAQQRQAKLLEEIEEENKRKQERELKKIREKEKKRDK
KKQLKLAKEEERQRREAERLAEQAAQKALEAKRQEEARKKREEQRLKREQEKKQQELERQ
KREEKQKQKEREKKLKKQQQEADREKMAREQRLREEEEKRILEERKRREKLDKEEEERRR
RELLEKESEEKERRLREAKIAAFFAPNQTKEGSDGCTTSSQLGLFEKKGDLVNDEDKLSS
HLLDSVPNALRQAPIGLKNTNNLSERNASSNLLNSSLFSSFNSVNPLISLEPNPLNRTLN
NSVNLTDFGRKPNGLHSPSSLLSNSNNFGLNPNARHSLSRANSPVHHYPFATPPSQRANK
YPLNNGANVPALLNSFSSPQLSPLVNRVLNEPSSSPLSSSSLKSPLSKEGVLNQQGHEQY
NFSLSPSIRNKLSPICRPSQGSSPKLKNNLSNTEERMGSRALLDDKTDSVITASNSTTSG
LSRDESSNPNNYELLNAFNQNTWKISRSTSNKSLIPESPWGVALGAFTPNASTQSIPWGN
RTWTD
NT seq 3258 nt   +upstreamnt  +downstreamnt
atgaatgataaagctcttcgcaccgaagcactcagtgtagggttagaacctccaagtttc
aaggatcttcttatacctattcccaactctggtacaaagaaaaagaataaaaagaagaaa
aaaccgaaagccaagaaaaatgtcgagactcaagcaaacgtggatttgcttgggtcggca
gggaccgattctgcagttacagacgttggcgcgaataatggtgtcatagatcatcaagcg
tctttggaactttcaaatttgaattctcgtatttctcatccgcagctggtctcggcaaat
ggtgatgattcatcgttgattaacgtcgaaggaatatcttcgacggattggcaattcact
cttgaatctgacgataccatagaacattctccccaatgtattctttctacctccagtttc
gtggatgaagccgagtttccagttcatatacctggtttggaagacgcgacgtcgtccaat
atgtcaccgaactccgttcaaaataatatgaatttgaatacagtagcgttaggttcgtca
acttcatctaaacggaaaaagaaaaagaagaagaagtcaaaagcaaatagtgcatcgttg
aatgtggatgatcaaagagattttgaacaagtttattctacggacgttgctattacttat
aggaatgggcaagcgctttcttattacaacggttctgtgcgtcaagccagtatgaataat
aacgttaacaataataaatccaaagatatttggagcagttcgaatactgaggagcgggag
caaattcgggaattttggctttccttaagtgaaagtgaacgcaggtcgttagttaaagtc
gaaaaagaagctgttttgcaaaaaatgaaagagcaacaaaaatactcatgctcttgttcg
gtgtgtggaaggaaacgtttagcaattgaggaagagttggaagtactgtatgatgcttac
tatgaagaattagaacaatatgctaatattcaacgtaaccttgcaaataccgagtctgta
aacgcttcagacgaaggttcagacaagtcccagaaaggaatcatctccgattcacctaag
cttttatcgattcctctgaacaacgtaccatcaaaatctctcaatgatgatataacccaa
gacgagttgaattcttcaaatgctgatgttgatgaagaagtcattgaaactactagcttg
gaggaaaaaaacgtggataatcaagaattcgtcacttctataagcaacggaaatcagaca
ttggaagacacttcacattcccctcaaacacagcctccttttcagcctccttatccctct
aaagcagatgagaaaaatagctatcattctgatctttataacttcgggagtagtttaacg
gtgaaaggaggtatcttaacggtagcggatgacctattgaagaatgatgggaagaagttt
atagaaatgatggaacagttagctgagcgtcgtatgcagcgtgaagataatagcaatttt
cacgaaccagagttatacgaaagcgggttggaatatgacgaagatgaagaagaagacgaa
gaagatgtagatgaggacgagttagatctaatgaccgatgaacaaaggatggaagaagga
cgcaggatgttccaaatttttgctgcccgtttatttgagcaacgtgtgttgcaagcttat
cgtgagaaagttgctcaacaacggcaagctaaacttttagaagagattgaggaggagaac
aaacgcaaacaggaacgtgagctcaaaaaaataagagagaaggagaaaaagagggataaa
aagaagcaattgaaattggcgaaggaggaagagcgtcaaagacgcgaagctgagcgtctt
gctgaacaggctgctcaaaaagcattggaagctaaaagacaggaagaagctcgcaagaaa
cgggaagagcaacgtttgaagcgtgagcaggagaaaaagcagcaagaacttgagcgtcag
aaaagagaggaaaagcaaaagcagaaggaaagagagaagaaactgaagaagcagcaacaa
gaggctgaccgtgaaaaaatggcgagagaacaacgactaagagaagaagaagaaaaacgt
attttggaagaaaggaagcgaagggaaaaattagacaaagaagaagaggaacgtcggcgt
cgtgagttacttgaaaaagaatcagaagagaaagaaaggagattaagagaagctaagatc
gctgctttctttgcacctaatcagactaaagagggttctgatggttgtactacttcttct
caacttggcctttttgaaaaaaaaggcgatctcgtaaacgatgaggataagctttcttca
catctcctagattctgtacctaatgctttgcggcaagctcccataggccttaagaacaca
aataatttatcggagcgcaatgcttcttctaatctgcttaattcttcgttattttcatct
tttaattccgtcaaccctttaatttctcttgagcctaatcctttaaatagaacacttaat
aattccgtaaacttaactgattttggtagaaagccaaatggtttacattctccatcttca
ctcctaagtaattccaacaattttggattaaatccaaatgctcggcattctcttagtaga
gccaattcaccggtgcatcattatccttttgcaacacctccttctcaacgtgctaataaa
tatccattgaataatggagcaaacgtaccagctttgcttaattcattttcaagtccacaa
ttaagtcctctagtaaatagagttttgaacgagccgtctagttcccctttatcgtcctca
agtttgaaatccccgttatccaaggaaggcgtcttaaatcaacaaggacatgagcagtat
aacttctcactgtcaccatctatccgaaataagctatctcctatttgtcgtcctagtcaa
gggagttctcctaagctgaagaataatttgtccaacacagaggaaaggatgggtagtcgt
gcactattagatgacaaaacagattctgttatcacagcttctaattcaaccacttctggt
ctgtcacgagatgaatctagtaatcctaataattatgagttgttaaacgcgtttaatcaa
aacacctggaaaatatctcggtcgacttccaataaaagtcttattcccgaaagtccatgg
ggcgttgcgctgggcgcatttactcctaatgcatctacccaatctattccttggggaaat
cgtacttggacagattaa

DBGET integrated database retrieval system