KEGG   Schizosaccharomyces pombe (fission yeast): SPAC2C4.04c
Entry
SPAC2C4.04c       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DUF2340 Blt1
Other DBs
NCBI-GeneID: 2542455
NCBI-ProteinID: NP_594507
PomBase: SPAC2C4.04c
UniProt: O14037
Position
I:complement(4265722..4266099)
AA seq 125 aa
MTGATLTVRVIRNFEYRTLKNVVFHDIDLATTTVDQFKKIIDERIQTDPSLKIYRTTHFD
TLKIYVKAQQHKTQNLAINLDHDDWILNDGAKTLSLCGIENETELSYFELAAYKAYQANP
VQKWL
NT seq 378 nt   +upstreamnt  +downstreamnt
atgacgggcgcaacgttaactgttcgagtaattcgcaactttgaatatcggacactgaaa
aacgtcgttttccacgacatagatctggccactacgactgtagaccagttcaaaaaaatc
atcgatgaacgcatacaaacggatccctcattgaaaatctaccgtactacccattttgac
acgttgaagatttatgtgaaagcccagcagcacaaaacccaaaacttggctattaattta
gaccacgatgattggattcttaatgatggagccaaaacattgtctctttgtggaattgaa
aatgaaactgagttgtcctactttgaacttgctgcctacaaggcctatcaagcaaatcct
gtacaaaaatggctttag

DBGET integrated database retrieval system