KEGG   Schizosaccharomyces pombe (fission yeast): SPAC2E12.02
Entry
SPAC2E12.02       CDS       T00076                                 

Gene name
hsf1
Definition
(RefSeq) transcription factor Hsf1
  KO
K09419  heat shock transcription factor, other eukaryote
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spo03000]
    SPAC2E12.02 (hsf1)
Transcription factors [BR:spo03000]
 Eukaryotic type
  Helix-turn-helix
   Heat shock factors
    SPAC2E12.02 (hsf1)
SSDB
Motif
Pfam: HSF_DNA-bind YabA
Other DBs
NCBI-GeneID: 2541888
NCBI-ProteinID: NP_594846
PomBase: SPAC2E12.02
UniProt: Q02953
Position
I:join(5059475..5059802,5060145..5061646)
AA seq 609 aa
MIQTASTISSNGGTNQGMESSSANSPEMNGTQNSMSVGMSGSGSSQNRKITQFSNKLYNM
VNDSSTDSLIRWSDRGDSFLVIGHEDFAKLVLPRYFKHNNFSSFVRQLNMYGFHKVPHIQ
QGVLQSDSPNELLEFANPNFQRDQPELLCLVTRKKAGSQPVEESNTSLDMSTISSELQNI
RIQQMNLSNELSRIQVDNAALWQENMENRERQRRHQETIDKILRFLASVYLDGKQKPPSK
VMPKSRRLLLEAKYPTVSPTNEPSAHSRPSPQGTTANSSSASISSLHNTTPDGEGKYRSV
QNGRALNYVSSFNSDSHSPKDYISQSYTNEPGLKKESADSFNNSIDSYISPNQSPNTDVP
SLNRDDTTDPKVVNTGDIINMLDDANSIEGSNMNSLSPLLFDYPNSLYPVNNTSSEQHHN
SYRGSVSNSQPSGNLSESTNLQPVQPVDYMSNSNPSYGSYNAEDQLTNFHPGYAMDQKRI
SKLSDGITKQDQNIQALADILGIPLGDGKIDDAGFSANSPTNLNLPVSSDLDSVLNIPPN
EDVFPDSNPVFDEFTNISNLTSPIEASNGNTFGSNPVSLPNQQKSVNPSLMTVSSPRQVR
KKRKSSIGA
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgattcagactgcatcgacaatttcaagcaatggcggaacgaatcagggaatggagtcc
agcagcgcaaattcaccggagatgaatgggacacaaaattcgatgtccgtagggatgtcg
ggctcaggttcttcacaaaataggaaaatcacacagtttagtaataaactgtacaatatg
gtgaacgactcgtcgacagattccttaattcgatggagcgaccggggtgattcgtttttg
gttatagggcatgaagattttgctaagctggttcttccacggtatttcaagcacaataat
ttttctagttttgttcggcaattaaacatgtacggctttcataaagtccctcatatacag
caaggtgttttacaatccgatagtcccaacgagcttctcgagtttgcaaatccaaacttt
caacgtgaccaacctgaattactatgcctagtaacgcgaaaaaaggccggtagccaaccc
gttgaagaatcaaataccagtttagacatgtctacgatatcctctgagctacagaatatt
cgcatccagcagatgaatttgtcgaacgaactcagtaggatccaagtcgataacgcagct
ctttggcaggaaaatatggaaaatcgcgagagacaacgtcgccatcaagagacgattgat
aagatccttcgttttcttgccagtgtatatttggatggtaaacagaagccacctagcaaa
gttatgcccaaaagtcgtcggctcttattagaagctaaatatcctacggtttcacctacg
aatgaaccgtctgcgcattcaaggccttcacctcaaggtactactgctaattctagtagt
gctagtatctcctctttacacaatacgactcctgatggagagggcaaatacagatccgtt
caaaatggacgagctttaaattatgtttcttcttttaattcggattcgcattcaccgaag
gattatatttctcaaagctatacgaatgagccaggacttaaaaaggaatctgccgattcc
tttaacaattcgattgactcatacatttctcccaatcaatcacctaatacggatgtaccc
tcattaaatcgagatgataccactgatcctaaagtcgtgaacactggtgatattatcaat
atgttagatgatgccaatagtattgaaggatcgaatatgaattccctgtcacctcttctt
ttcgactatcccaattcactttatccggttaacaacacttcttctgaacagcaccataac
tcttacagaggatcggtgtcaaattcccaaccttctggaaatttgtcggaatcgactaat
ttgcaacctgttcaaccagttgattatatgtcaaattcgaatccgtcctacggttcctat
aatgcagaagatcaacttacaaacttccacccaggctatgccatggatcaaaaaagaatt
tctaagttatcagatggaattacgaagcaggatcagaatatacaagcgttggcggatatt
ttaggtatcccgctgggtgacggaaagattgatgatgctgggttttctgctaattcaccc
accaacttgaacttgcctgtatcatctgatcttgacagcgtattaaacattcctccaaat
gaggatgttttcccggactcaaatcccgtttttgatgaatttacaaatatttcgaatcta
acgtcacccattgaagcatccaacgggaacacgtttggttcgaatcccgtttctttgcct
aatcagcagaaatcagttaatccatctttaatgacagtgtcctcccctagacaagtaaga
aagaagaggaaatcaagcattggtgcataa

DBGET integrated database retrieval system