KEGG   Schizosaccharomyces pombe (fission yeast): SPAC2F3.03cHelp
Entry
SPAC2F3.03c       CDS       T00076                                 

Gene name
rpa49, rpa51
Definition
(RefSeq) DNA-directed RNA polymerase I complex subunit Rpa49 (predicted)
  KO
K03005  DNA-directed RNA polymerase I subunit RPA49
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00230  Purine metabolism
spo00240  Pyrimidine metabolism
spo01100  Metabolic pathways
spo03020  RNA polymerase
Module
spo_M00182  RNA polymerase I, eukaryotes
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPAC2F3.03c (rpa49)
   00240 Pyrimidine metabolism
    SPAC2F3.03c (rpa49)
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    SPAC2F3.03c (rpa49)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPAC2F3.03c (rpa49)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     SPAC2F3.03c (rpa49)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_I_A49
Motif
Other DBs
NCBI-GeneID: 2541914
NCBI-ProteinID: NP_594382
PomBase: SPAC2F3.03c
UniProt: O14086
Position
I:complement(3925983..3927260)
Genome map
AA seq 425 aa AA seqDB search
MAGDELKGKKRKYRDSHSGDEKSVKILPLSESSLPPLVTTISGFYPPENTRFQLLKKSNQ
SNRDASLIGRTERVQFEAKNQSTATVEANYCLAVADKTGRVKKIVPAKYLNTFERNILAL
QEKDKFLKKKHGTVSGTVMEQRANLGLAFGTRKSQKAIMEESANRVKAETLGDVKDQLVS
NVQKATEALPTQEDIAAAQAQDRPIPPVNVGAESIEDAYKLEDIIPKEEFSAIYIKPLLE
NPDERNWAKLLPYRHSLFINERFQRLLSIEEVDQKRARILYYISLLQAFLFSRRSVGNRE
TLRKKLADPPEILIDGLIKRFTQTTGIGSVQVSSREVDKIICYILVLCLIVDNYSTDVLT
LANDLNVKTMKANELFRTVGCRIMAYTETQRMALGLNKTDAKNHKRAVLKIPLEFPKPRR
GRARN
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgacgagttaaagggcaagaagcggaaatatagagattcccattccggtgat
gaaaaatccgttaagatattgcctttgagtgaatcgagtttaccaccacttgtcacgaca
atttccggattttatccacccgaaaatacccggttccagcttctcaaaaagagcaatcag
agcaacagagatgcgtcgttaattggaaggacagagcgtgttcaatttgaggctaaaaat
caatcaacggctacggttgaggcaaattactgtttagctgttgctgataaaactggtcgt
gtaaaaaagattgttccagcaaagtatcttaatacttttgaaagaaatattttggcactt
caggagaaggacaaatttttgaaaaagaagcatggaactgtaagcggtactgttatggaa
cagcgtgccaacttgggtttggcatttggtacaagaaaaagtcaaaaagctattatggaa
gagtccgccaatcgtgtcaaagctgaaactttgggagatgtcaaggatcaattggttagt
aatgttcaaaaagctactgaagcacttccaacgcaagaagatatcgctgctgctcaagcg
caagatcgccctattcctcctgtcaatgtcggtgctgaatccattgaagatgcatacaaa
ttggaggacattattcccaaagaagagttttcagctatttacattaagcctctgttagaa
aaccctgacgagcgcaattgggccaaattattgccgtaccgtcactccttgtttattaat
gaacgcttccagcgattactttccattgaggaggttgaccagaagcgggcgagaattttg
tattacatttctcttttgcaagcttttttgttttctcgtcgttctgtgggcaaccgtgaa
actttacgtaaaaaattggctgatccaccagagattcttattgatgggttgattaaacgt
tttactcaaaccaccggtattggtagcgtccaagtatcatctcgagaagttgataaaatc
atatgttatattctggtattgtgcttaatcgttgataattactcaactgatgttcttacc
ttggcaaatgacttgaatgtcaagaccatgaaggctaatgagctttttagaacggtgggt
tgtcgaattatggcttacaccgaaactcaaagaatggctttaggtcttaacaaaactgat
gctaaaaatcataagcgtgcagtattaaaaattcccctagagttccctaaacctcgacgt
ggacgcgctagaaattag

DBGET integrated database retrieval system