KEGG   Schizosaccharomyces pombe (fission yeast): SPAC2F3.08
Entry
SPAC2F3.08        CDS       T00076                                 
Symbol
sut1
Name
(RefSeq) alpha-glucoside transporter Sut1
  KO
K15378  solute carrier family 45, member 1/2/4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC2F3.08 (sut1)
Transporters [BR:spo02000]
 Solute carrier family (SLC)
  SLC45: H+/sugar cotransporter
   SPAC2F3.08 (sut1)
SSDB
Motif
Pfam: MFS_2 BT1
Other DBs
NCBI-GeneID: 2541964
NCBI-ProteinID: NP_001342860
PomBase: SPAC2F3.08
Ensembl: SPAC2F3.08
Position
I:3935124..3938149
AA seq 553 aa
MSVDENQLENGQLLSSENEASSPFKESIPSRSSLYLIALTVSLLGVQLTWSVELGYGTPY
LFSLGLRKEWTSIIWIAGPLTGILIQPIAGILSDRVNSRIGRRRPFMLCASLLGTFSLFL
MGWAPDICLFIFSNEVLMKRVTIVLATISIYLLDVAVNVVMASTRSLIVDSVRSDQQHEA
NSWAGRMIGVGNVLGYLLGYLPLYRIFSFLNFTQLQVFCVLASISLVLTVTITTIFVSER
RFPPVEHEKSVAGEIFEFFTTMRQSITALPFTLKRICFVQFFAYFGWFPFLFYITTYVGI
LYLRHAPKGHEEDWDMATRQGSFALLLFAIISLAANTALPLLLEDTEDDEEDESSDASNN
EYNIQERNDLGNIRTGTNTPRLGNLSETTSFRSENEPSRRRLLPSSRSIMTTISSKVQIK
GLTLPILWLSSHVLFGVCMLSTIFLQTSWQAQAMVAICGLSWACTLWIPYSLFSSEIGKL
GLRESSGKMIGVHNVFISAPQVLSTIIATIVFIQSEGSHRDIADNSIAWVLRIGGISAFL
AAYQCRHLLPINF
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgtctgtagatgaaaatcaattggagaatggacaacttctatcctccgaaaatgaggca
tcatcaccttttaaagagtctatcccttctcgctcttccctctacttaatagctcttaca
gtttcacttttgggagttcaattgacttggtcggttgaacttggttatggtacaccgtat
ttattctcacttggtcttcgtaaagaatggacttcaattatatggattgccggtcctttg
actggaatattaattcagccaattgctggtatattgtccgaccgggttaattcaagaata
ggtcggcggagaccgttcatgctctgtgctagtttgttaggaacattcagcttattcctt
atgggctgggcccctgatatttgcctctttatatttagcaatgaggttctaatgaaacgt
gttactatcgttttggctacgattagcatttatttgcttgacgtggccgtcaatgtcgta
atggctagcactcgatctttaattgttgattcagtccgttcagatcaacagcatgaagca
aattcctgggctggaagaatgataggtgtaggcaatgtgcttgggtacttactaggctat
ttacctctatatcgcatcttctcctttctcaatttcacacagttacaggtgttttgcgta
cttgcctccatttccttggtactcacagttaccatcacaacaatatttgtgagtgaaagg
agattcccaccagttgaacacgagaaatcggttgctggagaaatctttgaattttttaca
actatgcgacaaagtattaccgcacttccatttacattaaaaagaatttgttttgttcaa
ttttttgcatactttggatggtttccatttttgttttatattactacctatgtgggtatt
ttatatttacgccatgctcctaaaggccatgaagaagattgggacatggcgactcgtcaa
gggtcgttcgcattactgctttttgctatcatttctcttgccgcaaatacagcacttcca
ttgttgctcgaggacacggaggatgatgaggaggacgaatcgagtgatgcatctaataat
gaatacaacattcaagaaagaaacgatctcggaaatataagaactggtactaatacaccc
cgtcttggtaatttgagcgaaacaacttctttccgttcggaaaatgagccctcacgacgc
aggcttttaccgtctagtagatcaattatgacaacgatatcctccaaggtacaaatcaaa
ggacttactcttcctattctgtggttgagctcccatgtcctttttggtgtttgtatgttg
agcacgatattcttgcaaacatcatggcaagcgcaggcaatggtagctatctgtggactg
tcctgggcatgtactctatggattccatattcgctattttcttcagaaatagggaagctt
ggattacgagaaagcagtggcaaaatgattggtgttcacaatgtatttatatctgccccc
caagtgttgagcaccatcattgccaccattgtatttattcaatcggagggcagtcatcga
gacatcgccgacaatagtatagcatgggtgttgagaattggaggtatatctgcatttcta
gccgcgtaccaatgccggcatcttttgcccatcaacttttga

DBGET integrated database retrieval system