KEGG   Schizosaccharomyces pombe (fission yeast): SPAC2F3.09
Entry
SPAC2F3.09        CDS       T00076                                 

Gene name
hem1
Definition
(RefSeq) putative 5-aminolevulinate synthase
  KO
K00643  5-aminolevulinate synthase [EC:2.3.1.37]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00260  Glycine, serine and threonine metabolism
spo00860  Porphyrin and chlorophyll metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01240  Biosynthesis of cofactors
Module
spo_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPAC2F3.09 (hem1)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPAC2F3.09 (hem1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPAC2F3.09 (hem1)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.37  5-aminolevulinate synthase
     SPAC2F3.09 (hem1)
Amino acid related enzymes [BR:spo01007]
 Aminotransferase (transaminase)
  Class II
   SPAC2F3.09 (hem1)
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Preseq_ALAS
Other DBs
NCBI-GeneID: 2542028
NCBI-ProteinID: NP_594388
PomBase: SPAC2F3.09
UniProt: O14092
Position
I:3940263..3941939
AA seq 558 aa
MERVVKLAAKHCPFVSKADPSALRRMAGAGLIRAGARCPVVRHALPVAAATGADVSRGFK
SDSKQMAMEPSLDEIHLKAGVVNTGSRTCRHADAVKAAAEAATTTPVTKKHQMPKHYASD
LNGVGPATTPRFDYDTFYREELDKKHRDKSYRYFNNINRLAKEYPLAHLADPNTRVEVWC
SNDYLNMGGHKKIREAMHQCIETYGGGAGGTRNIAGHNQHAVRLEKSLADLHQKPAALVF
GSCYVANDATLSTLGRKLPNCIFLSDEMNHASMINGIRNSRCEKIIFKHNDLVDLEAKLA
SLPLNRPKIIAFESVYSMSGNVAPISEICDLAKKYGAITFLDEVHAVGMYGPRGAGVAEE
TPGLLSRVDIITGTLAKSYGCVGGYIAASSTLVDMIRSLAPGFIFTTSLPPHVMVGALTA
VEHLKVSNVEREQQRSAVRRVKQSLSEIGIPVLSNDTHIVPAMVGDAHLAKLASDSLLHD
HNIYVQSINFPTVSVGTERLRITPTPAHNTEHYVQSLTNAMNDVWSKFNINRIDGWEKRG
IDVGRLCKFPVLPFTTTH
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggaacgcgttgtgaaattagctgcaaagcactgccccttcgttagtaaagccgatcct
agtgctttgcgtcgtatggctggtgctggtcttattcgcgcaggagcccgttgtccagtt
gttagacatgcacttcctgtggctgctgctactggtgctgacgtgtctcgtgggtttaaa
tccgactccaagcaaatggctatggagccttctttggatgagattcatctaaaggctggc
gtcgtcaatactggttctcgtacatgtcgccatgctgatgctgtcaaggctgctgctgag
gctgctaccactactcctgttactaaaaagcaccaaatgccaaagcactatgcttcggat
ttgaacggtgttggacctgccaccactcctagattcgactatgacactttttatcgtgaa
gaacttgataagaaacatcgagacaaatcttatcgttacttcaataatattaaccgcctc
gccaaagagtatcctcttgctcatttggctgatccgaatacgcgcgttgaagtctggtgt
agtaatgactacttaaacatgggtggtcataagaaaattcgggaggctatgcaccagtgt
attgaaacctatggtggtggtgccggtggtactagaaacattgctggacataatcagcat
gcagtacgccttgaaaagtccttggctgatttacatcaaaaaccagctgctctcgttttt
ggaagttgctatgtggccaatgatgccactttatctacacttggcaggaaattgcctaac
tgcatatttttgagtgatgaaatgaaccatgcttcaatgattaatggtattcgtaattct
cgttgcgaaaaaatcatattcaagcataatgatcttgttgatttagaagccaaacttgct
tcccttcccttaaatcgcccaaagatcattgcttttgagtcagtttatagtatgagtgga
aacgttgcacctatttccgaaatctgtgatttggctaagaaatatggtgctatcacattt
ttggatgaagtacatgctgttggtatgtacggacctcgtggagctggtgttgctgaagaa
actcctggtttgttaagtcgagtcgacattataacgggtaccttggctaaatcctatggt
tgtgttggtggttacattgcagcttctagcacgttagtcgacatgattcgttcacttgcc
cccgggttcatctttactacttcactccctcctcacgttatggtgggtgccttgactgcg
gtcgagcatctaaaggtttccaacgtagaacgtgaacaacaaagatctgctgttcgtcgt
gttaaacaatctctatctgaaatcggaattcccgttctttcgaatgatacccacattgtc
ccagccatggttggagatgcccacttggctaagttggctagtgactctttattacatgat
cacaatatttacgtccagagtattaattttcctactgtctctgttggaacagaacgcctc
cgtatcactcctaccccggcccataacaccgagcattatgttcaaagcttgaccaacgct
atgaatgatgtttggagcaaattcaacatcaatcgcattgatggatgggaaaaaaggggc
attgatgtaggtcgtctctgtaagttccctgtccttccttttactacgactcattaa

DBGET integrated database retrieval system