KEGG   Schizosaccharomyces pombe (fission yeast): SPAC2F7.17
Entry
SPAC2F7.17        CDS       T00076                                 
Name
(RefSeq) putative peptide chain release factor
  KO
K02835  peptide chain release factor 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:spo03012]
    SPAC2F7.17
Translation factors [BR:spo03012]
 Eukaryotic type
  Release factors
   SPAC2F7.17
 Prokaryotic type
   SPAC2F7.17
SSDB
Motif
Pfam: PCRF RF-1
Other DBs
NCBI-GeneID: 2541478
NCBI-ProteinID: NP_592987
PomBase: SPAC2F7.17
Ensembl: SPAC2F7.17
UniProt: Q09691
Position
I:569550..571876
AA seq 396 aa
MLLTKKVLWYFRHGIEYQIRSIACKKGYSEHNVSRVLIEKARSLSSEYLQFHQVNNKDQS
AMTNDTDLAKRIARLRRVHNAYSKFKSLSEQISDLKQMEAQESDAEVKMMAVTEINEISN
KIPKSIEDLENTLLPQADSYALPALIEIRPGVGGTEAAIFANELVEMYFQYANFKGWNCK
FISKSAVQGLEAITEAIFSIEGEGAYGHLMLEGGVHRVQRTPATETKGRVHTSTASVIVL
PQVSNDESSSLYDSSEVKIEVMRSRGAGGQHVNRTESAVRLTHIPTGITVSMQDSRSQHQ
NKEKAFLVLNSRLAALNAAKENEAERLKRKNQVTSSDRSEKLRTYNFNQNRVTDHRIGLS
MHDLSTFMQGEEKFDEFLEKIRIWNREQLLLHSEIV
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgcttctaactaaaaaagttttatggtactttagacatggaattgaatatcaaattcgt
agcattgcttgcaaaaaaggatactctgagcataacgtttcaagagtacttattgaaaaa
gcccgatcgctttcttcagagtatcttcaattccatcaagtaaataataaagatcaatcg
gcaatgacaaacgatacagatttagcaaagcgaatcgctaggcttcgacgcgttcataat
gcatattcgaaatttaaaagtttgtctgagcaaataagcgatttgaaacaaatggaggcc
caagagtcagatgcagaggttaaaatgatggcagtgactgaaataaacgaaataagtaat
aaaataccaaaaagcatagaagatcttgaaaacacattacttccacaagctgattcatat
gctcttcctgcattaatcgaaattcgtcctggtgtaggaggaacagaggccgcaatattt
gcaaatgaactagtggaaatgtattttcagtatgcaaattttaaaggatggaattgcaaa
tttatatcaaaaagtgcagtccaaggacttgaagcgataacggaggccatcttctctatt
gaaggtgagggagcttatggtcatcttatgttggaaggaggtgttcatagggttcagagg
actcctgctaccgaaactaaaggaagagttcatacgagtactgcatcagtaatcgtttta
cctcaggtgtcaaatgatgaatcctcttctctttacgattcatctgaagttaaaatcgaa
gtaatgagatctcgtggagccggtggacaacacgttaatagaacagaatccgccgtacgt
ttaacacacatacccactggtatcactgttagcatgcaagattctcgttctcagcatcaa
aacaaagaaaaggcatttcttgtactgaattcaagattggctgccttaaatgccgcaaaa
gaaaatgaggctgaaagactgaaacgtaaaaatcaagtaacgtcttcagatcgttcggaa
aagctacgaacttataacttcaaccaaaatcgagtaactgatcatcggataggtttaagc
atgcacgatttatcaacatttatgcaaggtgaagaaaaatttgacgagtttttggaaaaa
ataagaatatggaatcgtgaacagttgctattacactctgaaatagtatag

DBGET integrated database retrieval system