KEGG   Schizosaccharomyces pombe (fission yeast): SPAC2G11.13
Entry
SPAC2G11.13       CDS       T00076                                 

Symbol
atg22
Name
(RefSeq) vacuolar amino acid efflux transporter Atg22
  KO
K06902  MFS transporter, UMF1 family
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    SPAC2G11.13 (atg22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC2G11.13 (atg22)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC2G11.13 (atg22)
Membrane trafficking [BR:spo04131]
 Autophagy
  Other autophagy associated proteins
   Others
    SPAC2G11.13 (atg22)
Transporters [BR:spo02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Unknown major facilitator-1 (UMF1) [TC:2.A.1.24]
    SPAC2G11.13 (atg22)
SSDB
Motif
Pfam: ATG22
Other DBs
NCBI-GeneID: 2541826
NCBI-ProteinID: NP_593093
PomBase: SPAC2G11.13
UniProt: Q09812
Position
I:836383..837972
AA seq 529 aa
MNSPIQLHKKFSTTVWHVLSWILYAVGAGPTAIISMGVYVPLIVMKNAHDHGFLRTDHTI
PCSLYPEEPCSLNIVGPLWIDVSSIVFAASAISTFLQMAMMVSLGVICDYGNNRRYILFS
CVIIGSISGIILSWSPSSFLLGKIVFLILVDLNFIISQSCYDSFLPIFLRFYPITRGPIT
LESALQDETDDLDSYITNTTIDSSEEEPYLLEHSLILNESAPPADVEDEHKAKIAARLSS
VGFGSFFGAAILFQIIFTPILYKTNNNPIILPITVTVCSCWWLILSTPLCTIVTLPVENH
SSDAILTLLYNSVKESYHSFKHAMSISSIRLFLFSRLFINCGIQTSLSSAVIFGKARLNL
SNFQLTLLGMGISSFALLGTVIIPYLTEYFQLNSLQVVMIISILLPMAPLYGLLGYIPGF
ENAGIRTSADVFRATLFFGFFLGGAHSYCRSVYAQLVPSGKETRFFALYALISQTGVLFS
HISLTLISNYTSDLRAVYIFVIVVMTLPLSSLWIMYQHSKTPNLHRSSS
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgaattctccaatacaacttcacaagaagttttccactacagtttggcatgttctgagc
tggattctttatgcagttggggcaggtcctactgcaattataagtatgggggtgtatgtt
cctttaattgttatgaaaaatgcccatgatcatggttttttaagaacagatcacacaatt
ccttgttctttatatccagaagaaccttgctctttgaatatagttggtccgctatggatt
gatgttagttctattgtattcgctgcatcagctatttcaacttttttacagatggctatg
atggttagcttgggtgttatttgcgattatggaaataacagaagatacatcttgttttca
tgcgttatcataggttctattagtggtattatactttcgtggagtccctcgagttttctt
ttgggaaaaatagtgtttttgattctggtcgacttgaactttattatatctcaatcctgc
tatgacagctttctccctatttttttgagattctaccctatcacgagaggacctataaca
ttggaatccgctcttcaggatgaaacagatgacctagatagctacataacaaataccacc
attgattctagtgaagaagagccctatttgcttgaacacagcctaatacttaatgaatcc
gctcctcctgcagatgtggaagatgaacacaaggctaaaatcgctgctcgattatcaagc
gttggcttcggtagcttcttcggcgctgctattctctttcagattatttttactcccatt
ttgtacaaaactaataacaatccaataatcttgccaataactgttacagtgtgttcatgt
tggtggcttatactttcaacccccctttgtaccattgttacactacctgtggaaaatcac
tcaagtgatgctatcctgacactactttataatagtgtgaaagagtcgtatcattcattc
aagcatgcaatgagtatttcttcgattaggctattcctattttcacgactcttcattaat
tgtggaattcaaacttctctttcttctgccgttatttttggaaaagcaaggttgaatctc
tctaactttcagctgactttgctaggaatgggaatatcttctttcgcattgttaggcacc
gtaattataccctatcttactgagtattttcaactgaactcgttacaagtagtaatgatt
atttccatcctcttgccgatggctcctttatatggccttttgggttacattcctggattt
gaaaatgctggaatacgaacatcagctgacgttttccgggctactttattctttggcttt
ttcttaggaggtgcgcatagttattgtaggtccgtatacgctcaactagtgccatctgga
aaagaaactagattctttgccctctacgctttgatatcacaaaccggtgtgttatttagc
catatttctttaacacttatttcgaactacacatctgatttacgtgccgtctacattttt
gtaattgttgttatgactttacctttgtcttctttatggataatgtatcaacacagcaaa
acccccaacttgcataggtcctcctcttaa

DBGET integrated database retrieval system