KEGG   Schizosaccharomyces pombe (fission yeast): SPAC2G11.13Help
Entry
SPAC2G11.13       CDS       T00076                                 

Gene name
atg22
Definition
(RefSeq) vacuolar amino acid efflux transporter Atg22
  KO
K06902  MFS transporter, UMF1 family
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    SPAC2G11.13 (atg22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC2G11.13 (atg22)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC2G11.13 (atg22)
Membrane trafficking [BR:spo04131]
 Autophagy
  Other autophagy associated proteins
   Others
    SPAC2G11.13 (atg22)
Transporters [BR:spo02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Unknown major facilitator-1 (UMF1) [TC:2.A.1.24]
    SPAC2G11.13 (atg22)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATG22
Motif
Other DBs
NCBI-GeneID: 2541826
NCBI-ProteinID: NP_593093
PomBase: SPAC2G11.13
UniProt: Q09812
Position
I:836383..837972
Genome map
AA seq 529 aa AA seqDB search
MNSPIQLHKKFSTTVWHVLSWILYAVGAGPTAIISMGVYVPLIVMKNAHDHGFLRTDHTI
PCSLYPEEPCSLNIVGPLWIDVSSIVFAASAISTFLQMAMMVSLGVICDYGNNRRYILFS
CVIIGSISGIILSWSPSSFLLGKIVFLILVDLNFIISQSCYDSFLPIFLRFYPITRGPIT
LESALQDETDDLDSYITNTTIDSSEEEPYLLEHSLILNESAPPADVEDEHKAKIAARLSS
VGFGSFFGAAILFQIIFTPILYKTNNNPIILPITVTVCSCWWLILSTPLCTIVTLPVENH
SSDAILTLLYNSVKESYHSFKHAMSISSIRLFLFSRLFINCGIQTSLSSAVIFGKARLNL
SNFQLTLLGMGISSFALLGTVIIPYLTEYFQLNSLQVVMIISILLPMAPLYGLLGYIPGF
ENAGIRTSADVFRATLFFGFFLGGAHSYCRSVYAQLVPSGKETRFFALYALISQTGVLFS
HISLTLISNYTSDLRAVYIFVIVVMTLPLSSLWIMYQHSKTPNLHRSSS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaattctccaatacaacttcacaagaagttttccactacagtttggcatgttctgagc
tggattctttatgcagttggggcaggtcctactgcaattataagtatgggggtgtatgtt
cctttaattgttatgaaaaatgcccatgatcatggttttttaagaacagatcacacaatt
ccttgttctttatatccagaagaaccttgctctttgaatatagttggtccgctatggatt
gatgttagttctattgtattcgctgcatcagctatttcaacttttttacagatggctatg
atggttagcttgggtgttatttgcgattatggaaataacagaagatacatcttgttttca
tgcgttatcataggttctattagtggtattatactttcgtggagtccctcgagttttctt
ttgggaaaaatagtgtttttgattctggtcgacttgaactttattatatctcaatcctgc
tatgacagctttctccctatttttttgagattctaccctatcacgagaggacctataaca
ttggaatccgctcttcaggatgaaacagatgacctagatagctacataacaaataccacc
attgattctagtgaagaagagccctatttgcttgaacacagcctaatacttaatgaatcc
gctcctcctgcagatgtggaagatgaacacaaggctaaaatcgctgctcgattatcaagc
gttggcttcggtagcttcttcggcgctgctattctctttcagattatttttactcccatt
ttgtacaaaactaataacaatccaataatcttgccaataactgttacagtgtgttcatgt
tggtggcttatactttcaacccccctttgtaccattgttacactacctgtggaaaatcac
tcaagtgatgctatcctgacactactttataatagtgtgaaagagtcgtatcattcattc
aagcatgcaatgagtatttcttcgattaggctattcctattttcacgactcttcattaat
tgtggaattcaaacttctctttcttctgccgttatttttggaaaagcaaggttgaatctc
tctaactttcagctgactttgctaggaatgggaatatcttctttcgcattgttaggcacc
gtaattataccctatcttactgagtattttcaactgaactcgttacaagtagtaatgatt
atttccatcctcttgccgatggctcctttatatggccttttgggttacattcctggattt
gaaaatgctggaatacgaacatcagctgacgttttccgggctactttattctttggcttt
ttcttaggaggtgcgcatagttattgtaggtccgtatacgctcaactagtgccatctgga
aaagaaactagattctttgccctctacgctttgatatcacaaaccggtgtgttatttagc
catatttctttaacacttatttcgaactacacatctgatttacgtgccgtctacattttt
gtaattgttgttatgactttacctttgtcttctttatggataatgtatcaacacagcaaa
acccccaacttgcataggtcctcctcttaa

DBGET integrated database retrieval system