KEGG   Schizosaccharomyces pombe (fission yeast): SPAC30C2.04
Entry
SPAC30C2.04       CDS       T00076                                 

Definition
(RefSeq) putative methionyl and glutamyl-tRNA synthetase cofactor
  KO
K15437  aminoacyl tRNA synthase complex-interacting multifunctional protein 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPAC30C2.04
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SPAC30C2.04
SSDB
Motif
Pfam: tRNA_bind GAGA_bind DUF913 Vfa1 GST_C
Other DBs
NCBI-GeneID: 2543087
NCBI-ProteinID: NP_594656
PomBase: SPAC30C2.04
UniProt: Q9P6K7
Position
I:4638117..4639469
AA seq 450 aa
MSFLWAKEFCVLKYPYKLFITHKFSYLLRFETVTLNNIRSPQFYAKLTFSHHQPTVSGTM
STELKFISKYLQISIPETKEGPVSSLFKAVSEQKPELLGNTDFEKAQILEWTTKAFSPIE
TQSIVEQLDEFLKSSTFIAQDSGISVADLAVYARIHSYICGLSAKEGYKLNNVCRWFDFI
QHQESVMEAANSMSMKLANIDLNAPKIQRPSVIKKDKKEKKEGKPSQEASVKSVEKAPKG
LEGAKKEKQNKKEKKDKKDKKDKKEKAPKEPPKAATPVPSMIDFRIGFIEKAVKHPNADS
LYVSTIHCGDAEGPRTVCSGLVKYIPLEQMQQRKVIVVANLKPVNMRSVKSQAMVFCASS
PDKSVVEFVLPPENAEIGDRLTFEGFDTEEPEAQLNPKRKIWEAIQPGFTSGEDLICGYK
DESGLHRLFVKGKKDLGFCKAQTVVNGTLS
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgagttttctctgggcaaaagaattttgcgtattaaaatacccatataaactattcatt
actcataaatttagttatctacttcgatttgagacggtgacattgaataatatccgtagt
ccacagttctatgctaagttaactttttctcaccaccaacccacagtttcaggtacaatg
tccacggaactgaagtttatttccaaatatttacaaatttctatcccagaaactaaagaa
ggtccagtgagcagtttgttcaaagctgtgtctgagcagaagcccgagcttttaggaaac
actgatttcgagaaggctcaaattttggagtggactaccaaggcattttcacccatagaa
acccaatcgatcgttgaacagctagatgagtttttaaagtcttctactttcattgctcag
gattctggtataagtgttgctgatcttgctgtatatgctcgtattcattcttacatatgt
ggattatctgcgaaggagggatacaagcttaacaatgtttgtagatggtttgattttatt
caacatcaggaaagtgttatggaagctgctaatagtatgtcgatgaagttggcaaacatc
gatttgaatgctcctaagattcaacgtccttctgtaattaaaaaggataagaaggagaaa
aaggaaggaaagccttctcaggaagcctcagttaaatccgtcgagaaggctcctaaaggt
ttagaaggtgctaaaaaggagaagcaaaataagaaggaaaagaaagacaaaaaagataaa
aaagataaaaaggagaaggctcccaaggaacctcctaaagctgctactcctgtcccttcc
atgattgatttccgcattggctttattgagaaggcagtcaaacatcccaatgctgacagt
ttgtacgtttctaccatacattgtggtgatgctgagggaccaagaactgtttgcagtggt
ttagttaagtacattccattggaacaaatgcagcaacgcaaagttattgttgtcgctaat
ttaaagcccgtcaacatgcgtagtgtaaagtctcaagctatggttttttgtgcctcatct
ccagacaaatctgttgttgagtttgttttgcctccagaaaacgctgaaataggtgatcga
cttactttcgagggatttgatacggaggaacctgaagcgcaattgaaccctaagcgtaaa
atttgggaagctattcagcctggatttacaagtggagaggatttaatttgtggttacaag
gatgaaagtgggttgcataggctatttgtcaagggaaaaaaggacctcggattctgtaaa
gctcaaactgttgtcaatggcacattaagttag

DBGET integrated database retrieval system