KEGG   Schizosaccharomyces pombe (fission yeast): SPAC30D11.03
Entry
SPAC30D11.03      CDS       T00076                                 

Gene name
ddx27
Definition
(RefSeq) putative ATP-dependent RNA helicase Ddx27/Drs1
  KO
K13181  ATP-dependent RNA helicase DDX27 [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPAC30D11.03 (ddx27)
   03009 Ribosome biogenesis [BR:spo03009]
    SPAC30D11.03 (ddx27)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPAC30D11.03 (ddx27)
Spliceosome [BR:spo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    SPAC30D11.03 (ddx27)
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    SPAC30D11.03 (ddx27)
SSDB
Motif
Pfam: DEAD Helicase_C
Other DBs
NCBI-GeneID: 2543155
NCBI-ProteinID: NP_593214
PomBase: SPAC30D11.03
UniProt: Q09903
Position
I:complement(join(1116057..1116202,1116247..1116367,1116415..1118412))
AA seq 754 aa
MLWNTQYFRIEGMISLGWPRLAKTSILKFVPIAQNHRIRKMKVQDDFILTIDDSEDDIHY
DDYDADAVDEEMPSNVELKKKSKKATPAKDSDFNGEFLFEADVNKDLSSATDMNWDFDMG
SKTESNRASNTVDLDAIISRNRKPDDDEFPSSFPSEEELQEPEQENIDSDDEDLAIDGFG
AGAIAENEDESSQDESESEEEDDITEPVPSFANISTQDFNSDSAAGSSDSEEDEEEIAKK
NAFFAEGDKEKSMMTTTHSSFQSMNLSRPILKGLSNLGFEVPTQIQDKTIPLALLGKDIV
GAAVTGSGKTAAFIVPILERLLYRPKKVPTTRVLILCPTRELAMQCHSVATKIASFTDIM
VCLCIGGLSLKLQEQELRKRPDIVIATPGRFIDHMRNSQGFTVENIEIMVMDEADRMLED
GFADELNEIIQACPKSRQTMLFSATMTDKVDDLIRLSLNRPVRVFVDNKKTTAKLLTQEF
VRVRPQRELLRPAMLIYLCKELFHRRTIIFFRSKAFAHKMRVIFGLLSLNATEIHGSLSQ
EQRVRALEDFRDGKCNYLLATDVASRGIDIKGIEVVINYEAPATHEVYLHRVGRTARAGR
SGRAITLAGEGDRKVLKGVFKNSSAQNTKLVNRNLDFNKVEKFGKEIEELEPVVQKVLDE
EKQERELKIAERDLKKGENIMKYGDEIRSRPARTWFQSEKDKQASKASEAKDKKSLAKRK
KQMEKEEVPRAYKKTKNDRLSNKKSTKKSKSKRK
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgctttggaatacgcagtactttcgaattgaggggatgatttccttgggatggccaagg
ttagcgaaaacatcaattttgaaatttgtgccaattgcacaaaatcaccggattaggaaa
atgaaagtccaagatgatttcatcctcactattgatgactctgaagatgatattcattac
gacgattacgatgccgatgccgtagatgaagaaatgccttccaatgtggagttgaaaaaa
aaatcgaaaaaggccaccccggcaaaggattccgatttcaatggagaatttctattcgaa
gctgatgtcaacaaagatttatcctcagcgactgatatgaattgggattttgacatgggt
agtaaaacagaatcaaaccgtgcttctaatacagtggatctcgatgccattatatctcga
aaccgtaaaccagacgatgatgaattcccttcttcttttccctctgaagaggaacttcaa
gagcctgagcaggaaaatatcgattcagatgatgaagacttagcaattgatggattcggt
gcaggcgcaattgctgaaaatgaagacgagtcttcccaagatgaaagtgaaagcgaagag
gaagatgatattactgagcctgttccttcttttgccaatatttctactcaggatttcaat
tccgattctgctgctggttcctccgacagcgaagaagatgaagaggaaattgctaagaaa
aatgctttctttgctgaaggtgataaagaaaaatctatgatgaccactacacattcgtct
ttccaatctatgaatttgtcacgccctatcttaaagggcctttctaatcttggttttgaa
gtgccaactcagattcaagacaagacaataccacttgcacttttaggtaaagatatcgtt
ggtgctgcagttactggtagtggtaagacagcggctttcattgttcctattttggagcgt
ttgctctaccgtcccaaaaaggtccctactacaagagtattgatcctttgtcctactcgt
gagcttgctatgcaatgtcatagcgttgctacgaaaattgcctcttttactgacattatg
gtttgtctgtgtatcggtggtttgtccctcaagttacaagagcaggaacttcgtaaacgt
cctgacattgtcatcgccaccccgggtcgttttattgatcatatgcgcaattcacaagga
ttcactgtggaaaacattgagattatggtaatggatgaagccgatcgtatgctggaagat
ggttttgctgatgaactgaatgaaattattcaagcttgtccaaagtctagacaaacgatg
cttttttcggccactatgactgataaagtagatgatttaattcgtttatctttaaatcgg
ccagtacgagtttttgtcgataataagaaaactaccgccaaacttttaactcaggaattt
gtccgtgttcgaccacaacgtgagttacttcgcccagctatgcttatctatctctgcaag
gaattatttcatagaagaactattatcttcttcaggagcaaagcttttgctcacaagatg
cgagtcatatttggccttttatccttaaacgctaccgaaatccacggttcattgtcgcaa
gaacagcgtgtccgtgctttggaagactttcgtgatggaaaatgtaactatttgttggct
acagatgttgcatctcgtggtattgatatcaaaggcattgaggtcgtaataaattacgaa
gctccagctactcacgaagtttatcttcatcgtgttggtcgtactgctcgtgctggcagg
agtggtagagctattacattagccggtgagggcgatcgcaaagttcttaaaggtgtattc
aaaaattcttcagcgcaaaacacaaaattggtcaaccgtaatctggattttaacaaagtt
gaaaagtttggtaaagaaattgaggaattggaacctgttgttcagaaagtgctagatgaa
gaaaaacaagaacgagaactaaaaattgccgaacgcgatttaaagaaaggcgaaaacatt
atgaaatatggtgatgaaattcgttctcgtccagcacgtacctggtttcaatccgaaaaa
gataaacaagcttctaaagcctccgaagcgaaagataaaaagtctttagctaaaagaaaa
aagcaaatggaaaaggaagaggtgccccgagcatacaagaagacaaagaatgatagactt
agcaacaaaaagtctacaaaaaaatcgaaatctaagcgcaaatag

DBGET integrated database retrieval system