KEGG   Schizosaccharomyces pombe (fission yeast): SPAC30D11.05
Entry
SPAC30D11.05      CDS       T00076                                 
Symbol
aps3
Name
(RefSeq) putative AP-3 adaptor complex subunit Aps3
  KO
K12399  AP-3 complex subunit sigma
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC30D11.05 (aps3)
Membrane trafficking [BR:spo04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    SPAC30D11.05 (aps3)
 Endosome - Golgi transport
    SPAC30D11.05 (aps3)
SSDB
Motif
Pfam: Clat_adaptor_s Fuz_longin_1 RE_Bsp6I
Other DBs
NCBI-GeneID: 2542114
NCBI-ProteinID: NP_593212
PomBase: SPAC30D11.05
UniProt: Q09905
Position
I:complement(join(1110117..1110293,1110756..1110809,1110852..1111118))
AA seq 165 aa
MIYAVFIFNNKGKPRLTKFYTPIDESIQQKLIGDIYAAVSTRPPTACNFLESNLIAGKNR
IIYRQYATLYFVFVVDEGESELGILDLIQVFVEALDRCFNNVCELDLVFKFQEIHAILAE
VVSGGLVLETNLNEIVLAAQNQMPKTKRSNAMPFSNTLSSFATRF
NT seq 498 nt   +upstreamnt  +downstreamnt
atgatttacgctgtttttatatttaacaataaagggaaacctcgtctcacaaagttttac
actccaattgatgaatccattcaacaaaagttaataggagatatatatgcagctgtatcc
actaggcccccaaccgcttgtaattttttggaaagtaatttaattgcaggtaaaaataga
ataatttatcgccagtacgctactctctacttcgtttttgtagtagatgaaggtgaaagt
gaactaggaattctcgatctcattcaagtatttgttgaagcattagatcgatgctttaat
aatgtttgcgagcttgatttggtttttaaattccaagaaatacatgctattcttgctgag
gtagtatctggtggtcttgtcttagagacaaatctgaatgaaattgttttggcagctcag
aatcaaatgccaaaaaccaaacggtccaatgcaatgccattcagcaatacattaagttct
tttgctactaggttctag

DBGET integrated database retrieval system