KEGG   Schizosaccharomyces pombe (fission yeast): SPAC30D11.07
Entry
SPAC30D11.07      CDS       T00076                                 

Gene name
nth1
Definition
(RefSeq) DNA endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SPAC30D11.07 (nth1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC30D11.07 (nth1)
Enzymes [BR:spo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SPAC30D11.07 (nth1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SPAC30D11.07 (nth1)
 Prokaryotic type
     SPAC30D11.07 (nth1)
SSDB
Motif
Pfam: HhH-GPD HHH
Other DBs
NCBI-GeneID: 2543510
NCBI-ProteinID: NP_593210
PomBase: SPAC30D11.07
UniProt: Q09907
Position
I:complement(1106773..1107840)
AA seq 355 aa
MSKDYGTPPENWREVYDEICKMKAKVVAPVDVQGCHTLGERNDPKKFRFQTLVALMLSSQ
TKDIVLGPTMRNLKEKLAGGLCLEDIQNIDEVSLNKLIEKVGFHNRKTIYLKQMARILSE
KFQGDIPDTVEDLMTLPGVGPKMGYLCMSIAWNKTVGIGVDVHVHRICNLLHWCNTKTEE
QTRAALQSWLPKELWFELNHTLVGFGQTICLPRGRRCDMCTLSSKGLCPSAFKEKSGITI
TKRKVKTIKRVKKRPASESPPLSPLSLPTDDLYYQSIEDKSLIKLEDLDPVDSISHMNEP
LKKEPAADIDVDQKPPVAFHSTTKETRSLRRSKRVAKKSSQYFSQQSLQDIEDLV
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgagtaaagactacggaactcctcctgagaactggagggaggtttacgatgaaatttgt
aaaatgaaagccaaggtcgtagcgcctgtagacgttcagggttgtcatacattaggagaa
cgtaatgatccaaaaaaatttcgatttcaaacactggtggcattgatgctttctagccaa
acaaaagatatagtactgggtcctaccatgcgaaacttaaaagaaaaattagctggagga
ctttgtttagaagatatccaaaatattgatgaagtttctctaaataaactaatcgagaaa
gttggttttcataaccgaaaaaccatttatttgaaacaaatggcacgtattttatcagaa
aagttccaaggagatattccggacaccgtagaagacctaatgactctcccaggtgtgggg
cctaaaatgggatatctatgtatgagtattgcatggaataaaactgttggaattggagta
gatgttcacgtacatcgtatatgtaatcttcttcattggtgtaatacgaaaactgaagaa
cagactagagctgctttgcaaagctggctgcctaaggaattatggtttgagctgaaccat
acacttgtcggttttgggcaaacaatctgtttaccaagaggaaggcgctgtgatatgtgt
actttatcttctaagggcttgtgtcctagcgcctttaaagaaaaaagtggcatcacaata
actaagagaaaagtcaaaacgattaaaagagtcaaaaaaagacctgcttctgagtcacct
cctctatctccactctcccttcctacagatgatttgtattaccaaagcatcgaagataaa
tcacttataaaacttgaggacttggaccctgttgatagtatatcacacatgaatgaacct
ttgaaaaaagaaccagccgctgatattgatgtagatcagaagccacctgtcgcattccat
tcaactacaaaagaaactaggtcactgcgcaggtcaaagcgagttgcaaaaaaatcatcc
cagtatttctcccaacaaagtttacaagatattgaagatctggtttaa

DBGET integrated database retrieval system