KEGG   Schizosaccharomyces pombe (fission yeast): SPAC30D11.09
Entry
SPAC30D11.09      CDS       T00076                                 

Gene name
cwf19
Definition
(RefSeq) protein Cwf19
  KO
K24940  CWF19-like protein 2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPAC30D11.09 (cwf19)
Spliceosome [BR:spo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    SPAC30D11.09 (cwf19)
SSDB
Motif
Pfam: CwfJ_C_1 CwfJ_C_2
Other DBs
NCBI-GeneID: 2543189
NCBI-ProteinID: NP_593208
PomBase: SPAC30D11.09
UniProt: Q09909
Structure
PDB: 
3JB9

Position
I:complement(join(1101741..1101979,1102023..1102290,1102335..1103747))
AA seq 639 aa
MEKEKLTNRTSTHKFNETDRETNHSRRHRHHHSRHRESKHGRHDRSERPSSREAGDRSRH
ERFSKEPLEVKKLPVENEYFDSKFASASSMPSSKDNPQNNDFTNSLQGLDFGTFGSRIQR
EPIDRKSNKPGEIFVGATLQNESSTSTEHKDIEQLETEINESGINYKIGDNGSRWRMMKL
KRVFDMAQDQRRPVEEVALERYGSLKEFDFALEERDELELRKRTRKVQKEVPTGELYEKR
CADEFKTRKDSGNGATYYKVIPDPSVNKDTPTESDLNRLKADLLRAQLKKDPNYESLERE
YQKACDDFENSLHPSENSNSQATIPSKKRNFDDPTIDEMVQEEKLLNKQRKYGQNYEYAK
QIAKDKTYSNNLDYLDENAGKLSNRMKRGDVSLAQISSGGDLKKINHVLDTCPLCLNYET
QPLAPVISLSHRAYVSLPTQPELAKYHCLIVPTGHRINTLSCDEDEWDEIRNFMKCIALM
FDSMNLGVIFYENAPSPQRYMHTAIECIPVSKRILSLAPAYFREALSTSDEEWSQHRKII
DTLEGSKKYGKWAFRKMMVKELGYFHVWFSIDGGYGHVVEDEKAWGRHDQVPRQVFASML
NLPPEVIRRKGSWTGKKDPREDMFRSRFEKFDWTKGLID
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggaaaaggaaaagcttacaaataggaccagtactcacaaattcaatgaaactgacaga
gaaacaaatcactctagaaggcatcgtcaccaccactctaggcatcgtgagagcaagcat
ggacgacatgatcgcagtgaaaggccaagctctagagaagcaggtgaccgaagtaggcat
gaaagatttagtaaagagccattggaggtaaagaaacttcctgttgaaaatgaatacttt
gactccaaattcgcttctgcttcttccatgccatcctccaaagacaatccacagaataat
gactttactaattcattgcaaggtttggattttggtacgttcggttcgcgtatacaaaga
gaacctattgaccgaaagtccaataagcctggtgaaatttttgttggtgcaacattacag
aatgagagttcgacgagtacagaacataaagatatagaacagcttgaaaccgaaattaat
gagtcaggaattaattacaaaattggtgataatggctctcgatggcgtatgatgaagctc
aaacgcgtatttgacatggctcaagaccaacgacgccccgttgaagaagtagctctggaa
cgttatggttcattgaaagaatttgattttgccttggaagaaagagatgagttagagctt
cgaaaacgaactcgaaaagttcagaaagaagttcctactggcgaattatatgaaaaacga
tgtgctgatgaatttaagactagaaaagattctggtaatggcgctacatactacaaagta
atacctgacccttctgtaaataaagatactcccactgaaagcgatttgaatagattaaaa
gctgatttgttacgtgctcaacttaaaaaggatcctaactatgagtctttagaaagggaa
tatcagaaagcttgtgatgacttcgaaaactctttacacccttcggaaaattctaattcg
caagcaaccataccatcaaaaaaaagaaacttcgacgatcctactattgatgagatggta
caggaagaaaaattgttgaataaacaacggaaatacggccagaattatgaatacgcaaag
cagattgcaaaggataaaacttattctaacaatctggattatttggacgaaaatgcaggg
aaactttctaatcgaatgaagcgcggagacgtcagtctagctcaaattagtagtggtggg
gatcttaaaaaaattaatcatgttttggacacttgtcctctttgcctaaattatgaaaca
caacctttggcaccagtaatatctttaagtcatcgtgcttatgtttctttaccaactcaa
cccgaattagctaaatatcattgtttaattgttcctacaggacatcggataaataccctc
agctgtgatgaggatgaatgggatgaaatcagaaattttatgaaatgcatcgccctaatg
tttgattccatgaatcttggtgttattttttatgaaaacgcgccttcaccacaaagatat
atgcacacagctattgagtgtattccagtctctaaaaggatcctctcacttgcacctgct
tacttccgtgaagctttgtctacttctgacgaggagtggtctcaacatcgaaaaattatt
gatacattagaaggttcgaagaagtatggaaaatgggcttttcgaaaaatgatggttaag
gaattgggttattttcatgtttggttcagtattgatggtggctacgggcatgtcgtggaa
gacgagaaggcatgggggaggcacgatcaagttcctaggcaggtatttgccagtatgcta
aaccttcctcctgaagtaatcagaaggaaaggttcttggacaggtaaaaaagatccacgc
gaagatatgtttcgcagtcgttttgaaaaattcgattggaccaagggattaattgattag

DBGET integrated database retrieval system