KEGG   Schizosaccharomyces pombe (fission yeast): SPAC31A2.09c
Entry
SPAC31A2.09c      CDS       T00076                                 

Gene name
apm4
Definition
(RefSeq) putative AP-2 adaptor complex subunit Apm4
  KO
K11826  AP-2 complex subunit mu-1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SPAC31A2.09c (apm4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC31A2.09c (apm4)
Membrane trafficking [BR:spo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    SPAC31A2.09c (apm4)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Other DBs
NCBI-GeneID: 2541527
NCBI-ProteinID: NP_592921
PomBase: SPAC31A2.09c
UniProt: Q09718
Position
I:complement(join(403813..405079,405138..405202,405241..405249))
AA seq 446 aa
MISGLFIFNLKGDTLICKTFRHDLKKSVTEIFRVAILTNTDYRHPIVSIGSSTYIYTKHE
DLYVVAITKGNPNVMIVLEFLESLIQDLTHYFGKLNENTVKDNVSFIFELLDEMIDYGII
QTTEPDALARSVSITAVKKKGNALSLKRSHSSQLAHTTSSEIPGSVPWRRAGIKYRKNSI
YIDIVERMNLLISSTGNVLRSDVSGVVKMRAMLSGMPECQFGLNDKLDFKLKQSESKSKS
NNSRNPSSVNGGFVILEDCQFHQCVRLPEFENEHRITFIPPDGEVELMSYRSHENINIPF
RIVPIVEQLSKQKIIYRISIRADYPHKLSSSLNFRIPVPTNVVKANPRVNRGKAGYEPSE
NIINWKIPRFLGETELIFYAEVELSNTTNQQIWAKPPISLDFNILMFTSSGLHVQYLRVS
EPSNSKYKSIKWVRYSTRAGTCEIRI
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgatttcgggattgtttatttttaacctgaaaggtgacacgctcatttgcaagactttt
cggcatgatttaaagaaatcagtaactgaaatttttcgcgttgctattctaacaaatact
gattatcggcacccaattgtcagtattggatcaagtacttacatttacacgaaacacgag
gatctttacgtggttgccattaccaaaggaaatccaaatgttatgattgttttggaattt
ttggagagtctaattcaagatttgacacattattttgggaaactgaatgaaaatacagtc
aaagacaatgtctcctttattttcgagttgctggatgaaatgatagactatggtatcatt
cagactactgaacctgacgcacttgcaagatctgtcagcataacagctgtcaaaaagaaa
ggcaatgcactgtccttgaaaaggtctcattcctctcagttggcacacaccacttcctct
gaaataccagggtctgtaccatggcgtagagctggcattaagtatagaaaaaatagtatc
tacattgatattgttgaaagaatgaatttacttattagctctactggaaatgtgctacgc
tcagatgtttctggtgtcgtgaaaatgcgtgcaatgctttctggaatgcctgaatgtcag
tttgggctaaatgataagcttgattttaaattaaaacaatcagaaagcaagtctaaatca
aataactctagaaatccgtcctcagttaacggaggatttgtcattttagaagattgccag
tttcatcaatgtgttagattgccggaatttgaaaatgaacacagaattactttcattccg
ccggatggtgaggttgaattaatgagttatcgttcacatgaaaacataaatattcctttt
agaattgttcctattgtcgaacagttgtcgaaacaaaaaattatttatcgtatcagtata
cgagcagactatccacacaaactttcttcttctttgaactttcggataccggttcccaca
aatgtggtaaaagctaatcctcgtgtaaatcgaggaaaggcagggtacgagccctctgaa
aatattatcaattggaaaattccccggtttttaggcgaaactgaacttattttttacgct
gaggtagagttatctaatacaactaaccagcaaatatgggcgaagcctccaatatcctta
gatttcaatattcttatgtttaccagctccggtctacatgtgcaatacttaagggtcagt
gaaccttctaatagcaaatacaaaagtattaaatgggtaaggtactcaactagggctgga
acttgcgagatacgcatttaa

DBGET integrated database retrieval system