KEGG   Schizosaccharomyces pombe (fission yeast): SPAC31A2.11c
Entry
SPAC31A2.11c      CDS       T00076                                 

Gene name
cuf1
Definition
(RefSeq) Cu-sensing transcription factor Cuf1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Copper-fist
Other DBs
NCBI-GeneID: 2543198
NCBI-ProteinID: NP_592923
PomBase: SPAC31A2.11c
UniProt: Q09728
Position
I:complement(408030..409265)
AA seq 411 aa
MVVINNVKMACMKCIRGHRSSTCKHNDRELFPIRPKGRPISQCEKCRIARITRHLHVKCT
CNSRKKGSKCSTSSTTDLDSSSASNSSCSIPSSISEKLLPRDNVKTHCPKRSASCCGKKP
DVMPLKINLESQTDFMGMPLQSQRPHSESYRMLPEPEKFKSEYGYPSQFLPIEKLTSNVA
YPPNYNNYLKSPYQQPTNFPPEIQYNYSHSPQHSIQEAEEAAVYGPPVYRSGYQILYNNN
TDSIAAAAATHDLYPQPDVPLTFAMLADGNYVPLPSSTNTYGPSNSYGYEININESTNHV
DSSYLPHPIQLSNYFTLPSSCAQADAACQCGDNCECLGCLTHPNNATTLAALNHISALEK
ETISHTDLHHTFKHEVNSSNNYELTNDELAASSPLYTSSSVPPSHITTGST
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggttgtaatcaataacgttaaaatggcatgcatgaagtgcattcgtgggcatcgctct
agcacctgcaaacataatgaccgtgaactctttcctattagacctaaaggtcgtcccatc
agtcaatgtgaaaaatgtagaatcgctagaattactaggcatttacacgtgaagtgtacc
tgtaatagcagaaaaaagggttccaaatgttctacctcgagtacaactgatttagattct
tcatctgcttccaactcatcttgttctatcccatcctctatatctgaaaaactgttaccg
cgcgacaacgttaaaacgcattgtccaaaaaggagtgcttcgtgctgtggtaaaaaacct
gatgtgatgcctcttaaaataaaccttgagtctcaaactgactttatgggtatgccactt
cagtctcaaagaccacattcggaatcctatcgtatgcttcctgaaccagaaaagttcaag
tctgagtacgggtatccatcccagtttttgccaattgaaaagttaacttcgaatgtcgct
taccctcctaactataataattatttaaaatctccttaccagcagccgaccaatttccct
cctgaaattcagtataattattctcattctccccaacatagtattcaggaagcggaagaa
gcagcggtttatggtcctcctgtttatcgtagtggatatcaaattctttacaacaacaac
actgattctatagctgctgctgctgctacgcatgatttatacccacagccggatgttcct
ttgactttcgctatgctggcagatggaaattatgtacctttaccatcatcaactaataca
tatggaccctctaattcctatgggtacgagattaacataaatgagagcactaatcatgtc
gactcatcgtatctgccacatccaatccagctttctaattattttactctcccctctagt
tgtgcacaggctgatgctgcttgtcaatgcggtgataattgtgaatgcttaggttgtctt
actcatccaaacaatgcaactacattagccgctttaaatcatatttcagctttagaaaag
gaaaccataagtcatactgatctccatcatactttcaagcacgaagttaattctagcaat
aattatgaacttacaaacgatgaattagcagcatcctctccattatatacctcaagcagt
gttcctccttctcatattacaacaggttcaacatga

DBGET integrated database retrieval system