KEGG   Schizosaccharomyces pombe (fission yeast): SPAC31A2.12
Entry
SPAC31A2.12       CDS       T00076                                 

Definition
(RefSeq) putative arrestin/PY protein 1
  KO
K20062  arrestin-related trafficking adapter 4/5/7
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC31A2.12
Membrane trafficking [BR:spo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    SPAC31A2.12
SSDB
Motif
Pfam: Arrestin_C Arrestin_N LDB19
Other DBs
NCBI-GeneID: 2542940
NCBI-ProteinID: NP_592924
PomBase: SPAC31A2.12
UniProt: Q09729
Position
I:412084..413874
AA seq 596 aa
MNILSRKENVASYFDIRVAAEHDLIVIQGLADSAEPTPLSGSVVLCLNEAISVKAISLKL
VGKCRISWSEPSPTVRGGQRHNKQEYVVYEKNWIFVPYTGANRTLRAGNYEYPFHVMLPG
DIAESVEGLQSCYVVYRLKASIDRTGLASKMVKKKHIRLIRALPADAIEYTQTISVDNTW
PNKIEYTISVPTKAYAIGSYIPIHFVLVPLLKRLTIGKISITLKEYITLHVAHGYNGLPA
SKDEVRTVRSLQTEELEEFSDHYELTKNLELPSSLVECLQDCDLDGIKIRHKLKFSVSLR
NPDGHISELRAALPVVLMIPPQLFGDRAEVESLRENFESFNQPLPSYQNSMYDRLYDGLS
YSNLDTPLPSGATTPRRRDSMEPTYASNEAHRRQLIAGLTELALQQQPQGRSPNEHSPSN
HPEDFPPSFSLGSNPSSGAASAVITRNPSETSLADLSRVPSYKEATRSAVPLESPLQSTL
PSYEDVARIEHLSRPPSPGIVTPPQRTSPSFFVSPTESTRQSLDSRRSFEHSTSSSSGIS
PSHSSASLAHLSQASNPNGSSSAPHRPTSARVGSHRNALDALRRARMLPSGFSRRN
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgaatattctctcaaggaaagaaaatgtcgcttcctacttcgatattcgtgtagctgca
gagcatgatcttatcgtaattcaaggcctagcagactcggcagaaccgacaccactgtca
ggatctgtagttctgtgtctcaatgaagccatcagtgtcaaagcaatatctctaaaacta
gtgggaaaatgtcgcatctcctggtcagaaccttctccgactgtaagaggcggccaaaga
cacaataagcaagaatatgttgtttacgagaaaaactggatcttcgttccttatacgggt
gccaaccgtactttacgtgctggaaactacgagtatccgtttcacgtaatgcttcccggt
gatattgctgaatctgtcgaaggtcttcaaagttgctatgttgtttatcgtcttaaagca
agcatcgatagaacgggtttagctagcaaaatggtgaaaaagaaacacatccgtcttatt
cgagcattgcctgcggatgccattgaatatactcaaaccattagcgttgataatacttgg
ccaaacaaaattgagtataccatcagcgttccaacaaaagcctatgcaattgggtcatat
attcccattcattttgtattagttccgttgctgaagaggctaactattggaaaaatcagt
ataaccttgaaagaatacatcacgttgcatgtcgctcatggatataacggtttaccggca
tcgaaagatgaagtcaggaccgttcgttctcttcaaaccgaagaattggaggagttttcc
gatcactatgaacttacaaagaacttggaactaccaagttctcttgtggaatgtcttcag
gattgtgatttggatggaattaaaatacgtcacaaattaaagttttccgtttccctaaga
aatcctgatggccatatatcagaattaagagctgcattacctgtagtcttgatgatacct
cctcaattatttggcgatcgtgccgaagtagagtcgttacgcgagaattttgaaagtttt
aatcagcctttacctagctatcaaaacagcatgtatgatcgtctttacgatggtttgagc
tattccaaccttgatacacctctccctagtggcgcaactacaccaaggcgacgcgattct
atggagcccacctatgcttctaatgaagctcataggcgacaactcattgctggtttgaca
gagttggctctacaacaacaaccgcaaggaaggagccccaacgaacattcaccgtcaaat
catcctgaagatttcccgccttctttcagtttaggctctaatccatccagtggagctgcc
tctgctgtaattactagaaacccttcagaaactagtttggcagatctgagcagagtccct
tcttataaggaagcaacaagatcagccgttccattagaatcacccttacaatcaacatta
cctagttatgaagatgttgcacgaattgagcacctttcacgtcctccatcacctggtatc
gttactccaccacaacgtacatctccttcattttttgtttctccaactgaaagtacacga
caatccttggatagtcgtaggtcattcgaacactccacatcttcttcttcgggtataagc
ccatctcacagtagtgcttctttagctcatctttctcaagcctccaatccaaatggatcg
tcttctgccccgcataggcccacatcagctcgtgtaggaagtcaccgaaacgcactagac
gctttaagacgggcgcgtatgcttccatctggattttcaagaagaaattga

DBGET integrated database retrieval system