KEGG   Schizosaccharomyces pombe (fission yeast): SPAC31G5.07
Entry
SPAC31G5.07       CDS       T00076                                 

Gene name
dni1
Definition
(RefSeq) tetraspan protein Dni1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Fig1 SUR7
Other DBs
NCBI-GeneID: 2543166
NCBI-ProteinID: NP_594007
PomBase: SPAC31G5.07
UniProt: O14107
Position
I:2997453..2998157
AA seq 234 aa
MLFLHSVVQGTGTLCTLAAWILLALVMTGCQSSTTSKFQLFSLATNVAQINVGYFNMCVL
SANATLICKPQFTGCPGLTSISLTDVRSKFLINEVHPWMIVFSFCVCGVSFLMGVVSSLP
LIGRLEFLRNIRISLSFFSFFSILVTALFAHVAVSSFVMAVGNGTQNRVTASLGKKAMIF
LWCSMGLVTLTGITDSIILLVTSRTKKIRKTILEKSKVLTPSSSFSSKSSTTKY
NT seq 705 nt   +upstreamnt  +downstreamnt
atgctgtttcttcattcagttgtacaaggaactggaactctttgcacattagctgcatgg
attttacttgcactagtaatgacaggttgccaatctagtaccacctcgaaattccagttg
ttttctcttgcaactaacgtagcccaaattaacgttgggtattttaacatgtgtgtactt
tctgctaatgcgacgctgatctgcaaacctcaatttactggttgtcctgggttgacttcc
attagcttaacggatgtaaggtctaaatttctaatcaatgaagttcacccttggatgatt
gtcttttcattttgcgtatgcggtgtttcatttcttatgggtgttgtttccagccttccc
ttaatagggcgtttggaattcctgagaaacattcgtataagcctttcttttttctccttt
tttagtatactagtaactgctttgtttgctcacgttgctgtctcctcttttgtgatggct
gttggaaatggaacacaaaatcgagttactgcatctctaggcaaaaaggctatgatcttt
ttatggtgttctatgggacttgtgacattaacaggtatcacggattctattattcttttg
gttacttcaagaaccaagaagattcgtaagacgatactggaaaaaagcaaagtccttacc
cctagttcatccttttctagcaaatcctcaacaacaaagtattaa

DBGET integrated database retrieval system