KEGG   Schizosaccharomyces pombe (fission yeast): SPAC31G5.11
Entry
SPAC31G5.11       CDS       T00076                                 

Symbol
pac2
Name
(RefSeq) cAMP-independent regulatory protein Pac2
  KO
K21631  Gti1/Pac2 family transcription factor
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spo03000]
    SPAC31G5.11 (pac2)
Transcription factors [BR:spo03000]
 Eukaryotic type
  Other transcription factors
   Others
    SPAC31G5.11 (pac2)
SSDB
Motif
Pfam: Gti1_Pac2 DUF6425
Other DBs
NCBI-GeneID: 2542103
NCBI-ProteinID: NP_594011
PomBase: SPAC31G5.11
UniProt: Q10294
Position
I:3006138..3006845
AA seq 235 aa
MQTYTGIIKTPLDAIILFEACRIGLLPRVQRRLSDHERSLIRAGSVFVWDEREAGMRRWT
DGKSWSASRVSGSFLTYREMEGKRKPYHHGLSTDGSLKRSPSADTTGNSSLNAYSNEDSG
AASLSDEESVDDENLRGLHYKPNGLIKQSFSITTSLNHKLHLISYSSPIPDPSLVTPSSD
VNLSRITIPYGLYPDAGPPLVQAPKFLAPYDILVEKVACSEDARVLDKLRQALWL
NT seq 708 nt   +upstreamnt  +downstreamnt
atgcaaacttatacaggtatcattaagaccccgttggatgcgattatccttttcgaggcc
tgtcgaattggtcttcttccacgcgtccagcgtcgattgtccgaccatgaaagaagcttg
atacgagcaggcagtgtttttgtgtgggatgaacgggaagctggaatgcgccgttggact
gatggtaaatcatggagtgcttctcgtgtcagcggttcattcttaacctaccgagaaatg
gagggtaaacgtaaaccttaccatcacggtctttccaccgatggttcccttaaacgctct
ccctctgcagatacgactggtaatagttccctaaatgcttacagcaatgaggacagtgga
gccgcgagcttgagtgatgaagagtcggttgatgatgagaacctacgggggttgcattac
aaaccgaacggcttaattaagcagtcctttagtattactacctccttaaatcataaactt
caccttatttcctattcttcgcctatccctgatccttcattagtcacgccaagtagtgat
gttaacctttcacgtatcactattccatatggactgtatccagacgcgggtccaccgctt
gttcaagcaccaaagtttctcgctccttatgatattcttgtcgagaaagttgcctgtagc
gaagacgcgcgcgttttggataagttgcgtcaagccctatggctatag

DBGET integrated database retrieval system