KEGG   Schizosaccharomyces pombe (fission yeast): SPAC343.03
Entry
SPAC343.03        CDS       T00076                                 

Gene name
apc11
Definition
(RefSeq) anaphase-promoting complex subunit Apc11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04111  Cell cycle - yeast
spo04113  Meiosis - yeast
spo04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC343.03 (apc11)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPAC343.03 (apc11)
   04113 Meiosis - yeast
    SPAC343.03 (apc11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:spo04121]
    SPAC343.03 (apc11)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC343.03 (apc11)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     SPAC343.03 (apc11)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    SPAC343.03 (apc11)
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-RING_5 zf-Nse Zn_ribbon_17 zf-RING_UBOX zf-C3HC4 zf-HC5HC2H_2 zf-C3HC4_2
Other DBs
NCBI-GeneID: 2543187
NCBI-ProteinID: NP_593423
PomBase: SPAC343.03
UniProt: Q9UT86
Position
I:join(1643108..1643126,1643170..1643292,1643510..1643652)
AA seq 94 aa
MKVKILRYHAIANWTWDTPKDDVCGICRVPFDGCCPQCTSPGDNCPIVWGKCKHIFHAHC
IQNWLATSGSQGQCPMDRQTFVVADSTNEKSETQ
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaaggtgaaaatactgagataccatgcaattgctaactggacgtgggataccccaaaa
gacgacgtttgtggtatatgtcgtgttccattcgatggatgctgccctcaatgcacaagt
cctggagacaattgccccatagtttgggggaaatgcaagcatatatttcatgctcactgt
attcaaaactggttagctactagcggttctcaaggtcaatgcccgatggaccgtcaaact
tttgtggtagcagattctacgaatgaaaagtctgaaacacaataa

DBGET integrated database retrieval system