KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3A11.14c
Entry
SPAC3A11.14c      CDS       T00076                                 
Symbol
pkl1
Name
(RefSeq) kinesin-like protein Pkl1
  KO
K10405  kinesin family member C1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC3A11.14c (pkl1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:spo04812]
    SPAC3A11.14c (pkl1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    SPAC3A11.14c (pkl1)
Cytoskeleton proteins [BR:spo04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     SPAC3A11.14c (pkl1)
SSDB
Motif
Pfam: Kinesin Microtub_bd HIP1_clath_bdg NinB
Other DBs
NCBI-GeneID: 2542655
NCBI-ProteinID: NP_594189
PomBase: SPAC3A11.14c
Ensembl: SPAC3A11.14c
UniProt: Q92376
Position
I:3438848..3442117
AA seq 832 aa
MVIENTKDISINTGYKRQEDALNTDSEDLIYRPKKIIKTNQEDAVHDLKYENFVSKNHVL
QSDINGKKRDSNRDKAAVVTAPIASTHESNYEESVSKFKESWLPQLKDLIESHKTICEST
LAYESDQAMASSNTLKRIKDLKSKPKNIIQLERLHMLSNGEHRLLSKDETDDIESAYLNL
RSHLQVQEQVYAEKDHEYSLQLQSYREAAEKAKQDILETKENLSSELSISNIQLKEAKER
LEAANASYQKLRREHKELALYHEKKTHSLVCNLNGERKSFGDFVENEVKSYKHEYANICE
SLRRALVLIQGSCTEKILRFKEKILDLLEMKQQEENDRISHIEYENDLTVKKLKRRISEL
EMAVKEYESEKSYSEKEYEEKISSLRIELEDKLAEIDMLRNKLLKEEHKHHSTSEKLEEL
SKYVASIQDKERNNGQNALELQARIQQLERRNEDMYNKLLAEEIIRRKLHNDIQELKGNI
RVFCRVRPLLPSEESEYCIADVLQFPDKDALEPQKLILKGPNVESSLGHTYDRNYEFSFD
RVFAPESDNSSVFEEISQLIQSAIDGYNVSIFAYGQTGSGKTYTMSSQDGMIAMSIKHIF
NYLSTLREKGWVYKLRGQFLEIYNETIYDLLNKAEMLKNPKHDIHHDEKERRTTVDNVSI
IDFNEEDTVYKMLNRAGENRFIAATKANERSSRSHTVFMLYIDGENSRTKQICKGTLNLV
DLAGSERLSYSQAVGDRLRETQAINKSLSCLGDVIHALGNASNSTTKEKSHIPYRNSKLT
YLLKYSLGKGAKTLMFVNVSPLKSQFMDTLNSLRFATKVNDTKVGSIKHYKR
NT seq 2499 nt   +upstreamnt  +downstreamnt
atggtaattgagaatacaaaggacatttccataaacacagggtataaacgacaggaagat
gctttaaacacagattctgaggacttaatatatcgaccaaaaaaaattattaaaacaaat
caagaggatgcagtacatgatttgaaatacgaaaatttcgtatcaaaaaatcacgtttta
caaagcgacattaatggcaagaagagggacagcaatcgagacaaggccgctgtagtcaca
gcgccaattgcttctactcatgaatctaattacgaagaatctgtttccaaatttaaagag
agttggctgcctcaattaaaagatctcattgaatctcataaaacaatatgcgaatcaacg
ttagcctacgagagtgatcaagctatggcttcttctaatacattaaagagaataaaagat
ttaaaaagcaaaccaaaaaatattatacagttagaaaggttgcatatgctatctaatggc
gaacatcgtttattatcgaaagacgaaaccgatgatattgagtctgcatacttgaacctt
agatcacatcttcaggtacaagaacaggtttacgctgaaaaggatcatgaatattcgtta
caacttcaatcatacagagaggcagcagaaaaggccaagcaagatattttagaaacaaaa
gaaaatctttcctctgaattatcgatatcgaatatccagttgaaggaagccaaggaaagg
ttagaagctgcgaatgcaagctaccaaaagctacgtcgagaacacaaagaacttgcactt
tatcatgaaaagaaaacacattctctagtttgtaatctaaatggtgaacgaaaatccttt
ggggattttgttgagaacgaagtaaagtcatataaacatgaatatgccaatatttgtgaa
tcacttcggagagctctagtgctgatacaaggttcttgtactgagaaaattttgcgtttt
aaagaaaaaattctggacttattagaaatgaaacaacaagaagaaaatgatcgaatatcc
cacattgaatatgagaatgatttaacggttaaaaagcttaaaaggagaatatctgagttg
gaaatggcagtaaaagaatatgaatcggaaaaatcatactcggaaaaagaatatgaagaa
aaaatctcctctctgcgtatagaattagaagacaagttagctgaaattgacatgcttcga
aataaactgttaaaggaagagcataaacaccactctacatctgaaaaacttgaagaactt
tctaaatatgttgcaagtattcaagataaagaaagaaataatggccagaacgcattggaa
ctacaagctcgaatccaacagctggaacggagaaatgaagatatgtataataaactgtta
gcagaagaaataatcagacgaaagctgcataacgacattcaagaactaaagggaaatatt
cgagttttttgtagggttagaccactactcccaagtgaagaatccgaatattgcattgct
gatgttttacaatttccagataaagacgcactagagccacaaaaacttattcttaaaggg
cctaatgttgaatcatcactcgggcatacttatgatcgtaattatgaattttcctttgat
cgagtctttgctcctgaaagcgataactcgtccgtttttgaggaaatatcacagttaatt
caaagcgctattgatggttataatgttagtatatttgcatatggacaaacaggatcgggt
aagacgtacacaatgtcgtcacaagacggtatgatagcgatgtcaattaagcatatattt
aattatctatcaaccttgagggagaaagggtgggtgtataaattgagaggtcagtttttg
gaaatttacaatgaaacgatttatgatctattaaacaaagcggaaatgttgaaaaatcct
aagcacgatattcatcatgatgaaaaggaaagacgaacaacagtggataacgtttcaata
attgattttaatgaagaagatactgtttacaagatgctaaatcgagcaggagaaaatcga
tttatagcagcgacaaaagcaaatgaacggtcttcaagatcacacactgttttcatgctg
tatatagatggtgaaaattctagaaccaaacaaatatgtaaaggtacgctaaatctagtt
gatttggcaggttctgagcggttaagttacagtcaggcagttggggatagactacgagaa
acgcaagctattaataaaagtctcagctgtcttggcgatgttatccatgcacttggaaat
gcctcaaatagtaccacgaaggaaaagtctcacataccataccgaaattcaaagctaact
tatttgttaaaatattcacttggaaaaggtgccaaaaccctgatgtttgttaatgtgtct
cctttaaagtcgcaattcatggatacattaaatagtctgcgatttgcaacaaaagtcaat
gatacaaaagtaggttctattaaacattataaacgttaa

DBGET integrated database retrieval system