KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3A12.14
Entry
SPAC3A12.14       CDS       T00076                                 

Gene name
cam1
Definition
(RefSeq) calmodulin Cam1
  KO
K02183  calmodulin
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:spo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    SPAC3A12.14 (cam1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spo01009]
    SPAC3A12.14 (cam1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC3A12.14 (cam1)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC3A12.14 (cam1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC3A12.14 (cam1)
Protein phosphatases and associated proteins [BR:spo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     SPAC3A12.14 (cam1)
Membrane trafficking [BR:spo04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    SPAC3A12.14 (cam1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     SPAC3A12.14 (cam1)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPAC3A12.14 (cam1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg EFhand_Ca_insen Dockerin_1 Caleosin TerB Spore_III_AB
Other DBs
NCBI-GeneID: 2543039
NCBI-ProteinID: NP_593340
PomBase: SPAC3A12.14
UniProt: P05933
Position
I:join(1444930..1444932,1445059..1445508)
AA seq 150 aa
MTTRNLTDEQIAEFREAFSLFDRDQDGNITSNELGVVMRSLGQSPTAAELQDMINEVDAD
GNGTIDFTEFLTMMARKMKDTDNEEEVREAFKVFDKDGNGYITVEELTHVLTSLGERLSQ
EEVADMIREADTDGDGVINYEEFSRVISSK
NT seq 453 nt   +upstreamnt  +downstreamnt
atgactacccgtaaccttacagatgagcagattgcagaattccgtgaagccttttcactg
tttgatcgtgatcaggatggaaatatcacgtccaatgaattgggtgtagttatgagatcg
ttaggtcaatcgcctactgccgccgaattacaagatatgattaatgaggtcgatgccgat
ggtaatggcacaattgattttaccgaatttttgactatgatggcccgaaaaatgaaggat
accgacaacgaagaggaagttcgcgaagcctttaaagtcttcgataaagatggaaatgga
tacattacagtcgaggagttgactcatgtgcttacaagtcttggtgaacgtttgtctcaa
gaagaagtagccgatatgatacgtgaagccgacaccgatggcgatggtgtaatcaactac
gaagaattctctcgtgtcatttcttccaagtag

DBGET integrated database retrieval system