KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3C7.01cHelp
Entry
SPAC3C7.01c       CDS       T00076                                 

Definition
(RefSeq) putative inositol polyphosphate phosphatase
  KO
K21797  phosphatidylinositol 4-phosphatase [EC:3.1.3.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00562  Inositol phosphate metabolism
spo01100  Metabolic pathways
spo04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SPAC3C7.01c
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    SPAC3C7.01c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     SPAC3C7.01c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Syja_N
Motif
Other DBs
NCBI-GeneID: 3361512
NCBI-ProteinID: NP_001342934
PomBase: SPAC3C7.01c
Position
I:complement(2061806..2063641)
Genome map
AA seq 611 aa AA seqDB search
MNQDVRVFPDSIYLSCSKKKASLRIDRVDGCLSLSNSLDLSKTPDYNNVQLYGFIRLKIY
KYVVLVTSCDLHAAILGNNIYRARKFAIFPITRTLPFSTGLLNIKDEEELHYISLLNKHL
SKGQILFSPTLDLTCSLQRLRVLTQSFELTSKYNYRFFWNKYAFHELIELTNKDLGFQEW
IQPMIQGNIAITNSFLKTYNLRLCVITRHSPDYAGTRYFTRGVNAQGSAANFNEIEQIIM
IESPITLEEQMVLSFTQIRGSIPMFWAEVNDLHYRPLLSLQPLDYSETVFGKHFQELAND
YGDNLVVVNLLDQKGREAPLRSGFEKLCKRNKNPPLSYVYYDYHKQGSRNLPLFLAEIQS
LLIEGKYYAEHGSKTTAMQTNFVRTNCMDCLDRTNVIQTSIAQFILNMQLHDIGVLSSSE
SLEEYDSFLQDFRLIWANTGDYISDLYTGTPALKGDVTRHGTRTIFGAFKDLLNCFRRYI
LNNFFDGMLQDSYDLGLGVFRPYDSLSIPDLPLRFHWTRFVAPGIFLFTTIILTIQELFG
NPSLFCRLLYSIPMVNAGIYLYFHRRQYVNWPRLVLPTYAKGGWFSFRNHFRNITLKVFR
FLRSGSFKKSV
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggacgttagagtatttccagacagcatttatctatcatgttccaaaaaaaaa
gcttctcttcgaatagatagagtcgacggatgccttagtttgagcaattctcttgatctc
agcaagacacctgactataataacgttcagttatatggatttattcgattgaaaatatac
aaatatgtagttcttgttacaagttgtgatttgcatgcagcaattctcggaaacaatatt
tatcgggcaaggaaatttgctatcttcccaattacaaggactcttccattctccacgggt
ctgctaaatattaaagatgaggaagaactacattatatcagtttgctcaataaacatttg
tcaaaaggccaaatactttttagtccaacgttagatctaacctgttcccttcaaagatta
cgcgtactaacccaatcttttgaactgacatcaaaatataattaccgctttttttggaat
aaatatgcatttcatgaattaattgaattgacgaataaggatttaggctttcaagaatgg
attcaaccgatgattcagggtaatatcgccattactaactcgtttttaaagacttataac
cttagactgtgtgttattacacgacattctcctgactatgcgggtacgcggtatttcacc
agaggtgtaaacgcacaaggaagtgctgctaattttaatgaaattgaacaaataataatg
atcgaatcacccatcacccttgaagaacaaatggttctttcttttactcaaattcgagga
agtatccccatgttctgggccgaagttaatgatcttcattatcgacctttattatcttta
caacctcttgattatagcgagactgtgtttgggaagcattttcaagaacttgccaacgat
tatggggacaatcttgtggtggtcaatcttctagaccaaaaaggacgtgaagcacctcta
cggtctgggtttgaaaaattatgtaaacgaaataaaaaccctcctttgtcttatgtttac
tacgattatcataagcaaggaagtagaaatctccctttgtttcttgctgaaattcaaagt
ctcttgatagaaggaaaatattatgccgagcatggatctaaaactactgcaatgcaaacc
aactttgtaaggacaaattgtatggattgcttagatcggacgaacgtcattcagactagc
attgcacagtttattctaaacatgcaattacacgatattggtgtactttctagctctgag
agtttggaagaatatgatagttttttacaagattttcgcttaatatgggctaatactgga
gattatatcagtgatctctacactggtaccccggccttaaaaggcgatgtgactcgccat
ggaacgagaaccatttttggagctttcaaagatttattaaactgctttcgtagatatatt
cttaacaatttttttgacggtatgctgcaagatagctatgatttgggtcttggagtattt
cgtccttacgactcactttcgattccggacttgcctttgcgttttcactggactagattt
gtggcacctggaatttttttgttcaccacgataatattaactatacaagaattatttgga
aatccaagtctgttctgtcgtctgttatattctatccctatggtgaatgctggaatctac
ctatattttcatcgtagacaatacgttaattggcctcgtctagtactaccaacgtatgct
aagggaggttggttttcgtttcgtaatcatttccgaaatattactcttaaagtgtttcgt
tttttgcgttccggctctttcaaaaaaagtgtctaa

DBGET integrated database retrieval system