KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3G6.06c
Entry
SPAC3G6.06c       CDS       T00076                                 
Symbol
rad2
Name
(RefSeq) FEN-1 endonuclease Rad2
  KO
K04799  flap endonuclease-1 [EC:3.1.-.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03410  Base excision repair
spo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPAC3G6.06c (rad2)
   03410 Base excision repair
    SPAC3G6.06c (rad2)
   03450 Non-homologous end-joining
    SPAC3G6.06c (rad2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPAC3G6.06c (rad2)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC3G6.06c (rad2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC3G6.06c (rad2)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     SPAC3G6.06c (rad2)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    SPAC3G6.06c (rad2)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     SPAC3G6.06c (rad2)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SPAC3G6.06c (rad2)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPAC3G6.06c (rad2)
SSDB
Motif
Pfam: XPG_N XPG_I 5_3_exonuc CDKN3 HHH_2
Other DBs
NCBI-GeneID: 2543164
NCBI-ProteinID: NP_594972
PomBase: SPAC3G6.06c
Ensembl: SPAC3G6.06c
UniProt: P39750
Position
I:complement(5389586..5391518)
AA seq 380 aa
MGIKGLAQVLSEHAPASVKHNDIKNYFGRKVAIDASMSLYQFLIQVRSQDGQQLMNEQGE
TTSHLMGMFYRTLRIVDNGIKPCFVFDGKPPTLKSGELAKRVARHQKAREDQEETKEVGT
AEMVDRFAKRTVKVTRQHNDEAKRLLELMGIPFVNAPCEAEAQCAALARSGKVYAAASED
MDTLCFQAPVLLRHLTFSEQRKEPISEYNIEKALNGLDMSVEQFVDLCILLGCDYCEPIR
GVGPARAVELIRQYGTLDRFVKEADRSKYPIPEDWPYEDARRLFLDAEVLPGEEIELKWK
SPDADGIIQFLVKEKGFNEDRVKLGINRLEKASKTIPQGRLDSFFKPVPSSPKKPVDTKS
KGSAKRKRDSNKGGESKKKR
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgggaattaaaggtttggctcaagtactaagcgagcatgccccagccagtgtcaaacat
aatgatattaaaaattattttggacggaaagtggctatagatgcgtcaatgagtctttat
caatttttaattcaagttcgcagtcaagatggtcaacagctaatgaatgaacaaggcgag
actactagtcatttaatgggaatgttttatcgtacactccgaattgtcgataatggaata
aagccttgctttgtctttgatggaaaaccaccaacattgaagtcaggggaattagctaaa
cgtgtggcccgacatcaaaaagcacgagaggatcaagaggagacaaaagaggttggtaca
gctgaaatggtggatcggtttgccaaacgtacggtcaaagttactcggcaacataatgac
gaagcaaaacgtttactagagttaatgggaattcccttcgttaacgcaccctgtgaagca
gaagctcaatgtgccgctttagcccgttcaggaaaagtttatgctgctgcttctgaggac
atggacacattgtgcttccaagctcctgtacttttgagacacctgacatttagtgagcaa
agaaaggaaccaattagtgagtataacatagaaaaagcattgaatggtttagatatgtcg
gtggagcagtttgtagacttgtgtattcttttgggttgtgactattgtgaacctattcgg
ggagttggccccgctagagccgtcgagttaattaggcaatacgggactctcgatcgcttt
gtcaaagaggcggatcgatcaaaatatcctattccggaagattggccttatgaagatgcc
agaagactgtttttggatgcagaagtacttcctggtgaagagattgagttgaaatggaaa
agtcccgatgcagatggcattatacaatttctggttaaggaaaaaggtttcaatgaagat
cgtgttaaattggggatcaatagactagaaaaagcctcaaagacaattccacagggtcgt
cttgattccttttttaaaccagtcccttcttctcccaaaaaacctgtagatacaaagagc
aaaggatcagcaaaaaggaaaagagattcaaataagggtggtgaaagcaagaaaaagcgt
tga

DBGET integrated database retrieval system