KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3G9.12
Entry
SPAC3G9.12        CDS       T00076                                 

Gene name
peg1
Definition
(RefSeq) CLASP family microtubule-associated protein
  KO
K16578  CLIP-associating protein 1/2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC3G9.12 (peg1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:spo04812]
    SPAC3G9.12 (peg1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     SPAC3G9.12 (peg1)
Cytoskeleton proteins [BR:spo04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Cytoplasmic linker proteins (CLIPs)
     CLIP-associating proteins
      SPAC3G9.12 (peg1)
SSDB
Motif
Pfam: CLASP_N
Other DBs
NCBI-GeneID: 2543399
NCBI-ProteinID: NP_594084
PomBase: SPAC3G9.12
UniProt: O42874
Position
I:complement(join(3152779..3157050,3157130..3157197,3157240..3157288))
AA seq 1462 aa
MADKDAQDFLKFLKSNASTDEKTRCLDTLRSFFNKNNIPNADLGLFVECFRLALTTVNPL
LLRSSVACFETFLRRLRAQYPTWLKFRVPMLKNLVIDHIASRDLQKRVLNILIDLWHFNP
SEIEKSLIHLSTTSKSAETRIQCFKWFVLAHNAHLSFDVKSLRPALYINLENANPSVREE
AKEVLLLIYKNLSTSAKMQFITDVETTSGLRREILQSLVEELSLISSSSEVIIVQNSASS
FQPAPFMTAVATLYPGVELENVKPLLANFSKQLEQDSASMLPAFEGRETEQNWSVRQDSV
LRLRQYLRGNACIDYLPELLSVLKTLLPGILLALLSLRTTLSSSAIQLIKEMAIILKSNI
DPFLELILPNLLKVCSVTKKLASQAANVTFAAILVNCGVLSRNLSFISLAAHDTNAQLRV
FSSNWIFMLISLSPELKNLASLQTNLKAFEKLICRGLADSNSQVREVYRKSFWKLSEYFP
SVQEELTNTLEPSVLKQLHLANPNRQAASFNFSGPKRAPIRPLSNLRSFSKSQKEETSSN
SSNSSGTRRLGLPQRATPASRERVLPYTRSQAFHSTSLPPSLPSGHSPSIAIPSKRSVSA
TIKDESKTFELLKNIQRKYELILSGSSVDLPSAEFLSSNLTDALYSGSSICYSLIFSHSL
LDLTFQYVDIASLLSQFLLCVYDPSNVGHSFALASFPYVKSHYDAHKYFPIVFDVLMNIS
NMAPHVKVFPFNTNQKRLIIHGCLLWLKEISDTKLNQLENKPFFVTDKLRYYSSKILAMT
AKTKLTSKNWIPLSGLLFSLRAHDTFMFDGLLDRLNEESRTKLVSSWSKQDAFDYSKSST
HQEHLSKNLPTLNTSSSSNSSQTDLLVPHGKGETKETEMQSPIESKEGLLSKDTHIESPQ
GTSLEKENEEEGKNPVESNCSEESLDDHNIDQTLVNKKETLAQDSESLLQKNNALNEKGF
ENQFGLSSSAAKVLNKDTLDHVSGPISNSVSSSFKDFTRTPFKEINGERETGFELTSYVN
ALSKKDDINVQKTENVDESVGLNAMFMDNVNQDSLNSVDQSSGKDKLLLTSSTPNKPTTF
FMPANEEILGSPAKDYDIHDQSYSVHELHSENMRENVGQSSLIYNNRDYMNTPMNDFSLS
FSEIKGGILESPVESPMTGTISPIDADESVLHDIPAYESLNKSESNKYQEQAYSTPLHHT
LNVLPKNKWILSRMHKMENGSPINVDKNLDDAVAALEAAVKELNDGSVNTKTLKFCIKVC
KETPSMLYHSHGLLPAILHYIESNNSAMHISDCLILLHEFLVQGYQGVDMHTYHNIICIL
IEKAEKCKDEPVILAGIEDNITLIAEIADLQGLYEFTQQRLQSLNTETGEKSAPLLLMLL
SAILMRLKDLEFLETKDLLRHVVLKYIDHTNPEIRKATFNVCLAVNTIVNNVDETFSILG
GLNEGQRLLFMHYLKMKSDEKN
NT seq 4389 nt   +upstreamnt  +downstreamnt
atggcggataaggatgcgcaagattttttaaagttccttaaaagtaatgcatccaccgat
gaaaagacgagatgtctagatacccttcgctctttctttaataaaaacaacattcccaat
gcagatctcggtttgttcgtggaatgcttcagacttgctttaactaccgtcaacccttta
ctccttagatcttctgttgcatgctttgaaacttttttacgccgtttacgtgcccaatat
cctacatggttaaagtttcgcgtacctatgctaaaaaatcttgtcatcgatcacatagcc
tctcgcgatttacaaaagcgtgttcttaatatcttaattgacttatggcactttaaccca
tctgaaattgagaagagtcttatacatctttcaacaacaagtaaaagtgccgaaaccaga
attcagtgtttcaaatggttcgtccttgcacataatgctcatctcagttttgacgtaaaa
tctttgcgtcccgctctttatataaacctagaaaatgccaacccttctgtacgagaggag
gcgaaagaagttttgttactgatttacaaaaatctatctacttcagctaaaatgcaattt
ataaccgatgttgaaactacctcgggtcttcgaagggagatcttacaaagcttagtggaa
gagctgtctctcatatcgtcttcctccgaagtaataatagttcaaaattcagcatcttcg
tttcagcccgcacccttcatgacagccgtagctactctttaccctggagtagagttggag
aatgtaaagccattgttggcaaatttttccaaacaacttgaacaagatagtgcttctatg
cttcctgcctttgaaggtcgtgagactgaacaaaattggtcggtcaggcaggattcagtt
ttgcgacttcgtcaatatctaaggggaaatgcatgtattgattatcttccagaactactt
tcagttcttaaaactcttttgcctggaattttgttggctttgttgtcattgcgtacaact
ctaagttcttctgccatacaactgataaaagagatggccatcatattaaaaagcaacatt
gatccctttttagaacttattctaccaaacctattaaaagtttgctcagttacgaaaaaa
cttgcatctcaagccgctaatgtaacatttgctgccattcttgtaaattgtggagtcttg
tcgcgaaatttatcctttatctctttagcagctcatgatacaaatgctcaacttcgcgtt
ttctcaagtaattggatttttatgttgatatccttatctcccgagttaaagaaccttgca
tctttgcaaactaatttgaaagcttttgaaaaactgatttgtcgcggacttgctgactcc
aattctcaagtacgggaagtttatcgaaaatcgttttggaagctttctgaatattttcct
tccgttcaagaagagttgactaacactcttgaaccttctgtgttaaaacaattacatttg
gcgaaccctaatcgtcaagctgcttcttttaattttagtggtcctaagcgtgcaccaata
cgtcctttgtcaaatttgcgctcgttcagtaagtctcaaaaggaagaaacttcttctaat
tcttctaattcatccggaactcgaagattaggtcttcctcaaagagcaactcctgcctca
agagagagggttcttccatacactcgttctcaggcatttcattctactagcttaccaccc
tctttaccctctggtcattcaccatctatagccataccatctaaaaggtccgtcagcgct
actataaaggatgaatccaaaacctttgaattactaaagaatatacaaagaaaatatgaa
ttgattttatctggaagtagcgttgacttaccttctgcggaattcttatcgtccaactta
acagatgcgctttatagtggaagctcgatttgttactcacttatttttagtcactcttta
ttagacttaacatttcaatatgttgacattgcttcattactttcccaatttctcctttgt
gtttatgacccatcaaatgttggacattcctttgcacttgcttcattcccatatgtcaaa
agtcattacgatgcacataaatacttcccaatagtcttcgatgttttgatgaacatctca
aacatggctccacatgttaaagtattcccttttaatactaatcaaaaaagacttatcata
catggttgtcttttatggctcaaagaaatcagtgatacaaagttgaatcaattggaaaac
aaacctttttttgtaaccgataagttgagatactattcctcaaaaatattggctatgact
gctaagacaaaattaacttccaaaaattggataccactcagtggattacttttttcttta
agagctcatgatactttcatgtttgatggcttacttgatagattaaacgaggaatcaaga
acaaagttggtaagctcttggagcaagcaggatgctttcgactattctaagtcatcgaca
catcaagaacacttaagcaaaaatttaccaactcttaatactagttcttcatctaattct
tcacaaaccgatttgctagtaccacatggcaaaggtgagaccaaagagactgagatgcaa
tcgccaatagaaagcaaagaggggctactgtctaaagatactcatattgaatcgccgcaa
ggtacttctttagaaaaggaaaatgaagaagaaggtaaaaatccagttgagtcaaattgt
tccgaagaatcactggatgatcacaatattgatcaaactctcgtaaataaaaaagaaaca
cttgctcaagattctgaaagtttattgcaaaaaaataatgctttaaatgaaaaagggttc
gagaatcaatttggattatcttcctctgctgcaaaagtcttgaataaagatacgctggat
catgtaagcggcccgatttctaattctgtttcttcttcattcaaagactttacaaggaca
ccgttcaaagagattaatggagaaagagagacaggttttgagctcactagttatgtcaac
gcattaagtaaaaaagacgatatcaatgttcaaaaaactgagaatgtcgacgagtcagtg
ggattgaatgcgatgtttatggataacgtaaatcaagattctttgaatagtgtggaccaa
agttcagggaaagacaagttattattaacaagttcaactcctaataaaccaactactttt
tttatgccagctaatgaagaaatactgggttctcctgcgaaagattacgatatccatgat
cagtcttattcagttcatgaattacattcagaaaatatgagagaaaatgtgggtcagtct
agcttaatctataacaatcgtgattatatgaatacaccaatgaatgacttcagtctcagc
ttttcagaaataaaaggtggtattctagagtctccagtggagtcaccaatgacaggaaca
atatcgcctatcgatgcagatgaatcagttctccacgatatacctgcatatgaaagtttg
aataaatcggaaagtaataaataccaggaacaagcatattcaactcctcttcatcacacc
ttgaatgtattaccgaaaaataaatggattttgtcacgtatgcacaagatggaaaatggg
agtccgataaatgttgacaaaaacttggacgatgcagtagcagcattggaagctgcggta
aaagaactgaatgatgggtcagtgaataccaaaactttaaaattttgcattaaggtttgc
aaagaaacaccttcaatgttgtatcatagtcatgggcttttgcctgctatattacattat
atcgaatcgaataattcagctatgcacatttctgattgtttaatattattacatgaattt
ttggttcagggatatcaaggtgtggatatgcacacttatcacaatatcatttgcatcctg
atcgaaaaggcagaaaagtgcaaagatgaaccagtcatattggcaggaattgaggataac
ataacacttattgcagaaatagcggacctacaaggcttgtacgaatttactcaacaaagg
cttcaatccttgaatacggaaaccggagagaaatctgctccattgttactgatgctactg
tcagctatactgatgcgtttaaaagatttggagtttcttgagacaaaagacttactcaga
catgtggttttaaaatacatagatcatacaaatcctgagataagaaaagcaacttttaac
gtgtgtttggcggtgaatacaatagtcaacaatgttgatgaaacgttttcaatattggga
ggattaaatgaaggacaaaggcttcttttcatgcattatttaaagatgaagtctgatgaa
aagaattag

DBGET integrated database retrieval system