KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3G9.15c
Entry
SPAC3G9.15c       CDS       T00076                                 

Gene name
fcf2
Definition
(RefSeq) putative rRNA processing protein Fcf2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Fcf2 DUF3196 DUF1523
Other DBs
NCBI-GeneID: 2543250
NCBI-ProteinID: NP_594087
PomBase: SPAC3G9.15c
UniProt: O42877
Position
I:3145867..3146559
AA seq 230 aa
MTEIGLSVDLATISKLLESAKSTLQEKQASDDDKHGQQKLLTKIPKIISSSFELPSYFEK
KFVMGLKKDELVENSESYINDASFEPTVPIYESHVSAPGISKKKKNIKDTAGSNWFDMPA
TELTESVKRDIQLLKMRNALDPKRHYRRENTKSMPKYFQVGSIVEGPQDFYSSRIPTRER
KETIVDELLHDSERRSYFKKKYLELQKSKMSGRKGQYKKLQQRRKPSYLK
NT seq 693 nt   +upstreamnt  +downstreamnt
atgactgagattgggctctctgtagatttagcaacaatctcaaagctactagaatctgca
aaatccacattacaagaaaagcaagcgtctgacgatgataagcatggccaacaaaagttg
ctcaccaaaattcccaaaataatcagctcttcttttgaattgccttcatattttgaaaag
aaattcgttatgggattgaaaaaagatgaattagtggagaatagcgagtcatatattaat
gatgcgtcgttcgagccaacagtacctatttatgaaagtcatgtttcagcccctggtata
tcaaagaagaagaaaaatattaaagacactgctggatcgaattggtttgacatgcctgcc
accgagctcacagaatcggtgaaacgcgacattcagctattgaagatgagaaatgcacta
gatccgaaacggcattaccgaagggaaaacacgaaatctatgcccaaatactttcaggtg
ggttccatcgttgaaggtcctcaggacttttactctagtcgtatccccactcgagagcgc
aaagagacaattgttgacgaattattgcacgattcagaaagacgatcgtacttcaagaaa
aaatatctagaattacaaaaatcgaaaatgagtggacggaaggggcaatataaaaaactt
cagcagcgccgaaaaccttcttacttgaaatag

DBGET integrated database retrieval system