KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3H1.05
Entry
SPAC3H1.05        CDS       T00076                                 

Name
(RefSeq) putative CAAX prenyl protease
  KO
K06013  STE24 endopeptidase [EC:3.4.24.84]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00900  Terpenoid backbone biosynthesis
spo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPAC3H1.05
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spo01002]
    SPAC3H1.05
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC3H1.05
Enzymes [BR:spo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.84  Ste24 endopeptidase
     SPAC3H1.05
Peptidases and inhibitors [BR:spo01002]
 Metallo peptidases
  Family M48: Ste24 endopeptidase family
   SPAC3H1.05
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPAC3H1.05
SSDB
Motif
Pfam: Peptidase_M48_N Peptidase_M48 DUF4579
Other DBs
NCBI-GeneID: 2543456
NCBI-ProteinID: NP_593547
PomBase: SPAC3H1.05
UniProt: Q10071
Position
I:join(1938900..1939004,1939075..1940394)
AA seq 474 aa
MSPGLCFLKEISVIQATPKPTTRSFANCCKMGILQHLMHILDIPGFPWKIVIAGFSIGKY
AWDLYLRRRQVPYLLREKPPAILAEHVDEKKYQKALSYARDKSWFSTIVSTFTLAVDLLI
IKYDGLSYLWNITKFPWMDKLAASSSRFSLSTSITHSCVFMFGLTLFSRLIQIPFNLYST
FVIEEKYGFNKSTLKIFVIDLLKELSLGGLLMSVVVGVFVKILTKFGDNFIMYAWGAYIV
FGLILQTIAPSLIMPLFYKFTPLENGSLRTQIEELAASINFPLKKLYVIDASRRSTHSNA
FFYGLPWNKGIVLFDTLVKNHTEPELIAILGHELGHWYMSHNLINTIIDYGMSLFHLFLF
AAFIRNNSLYTSFNFITEKPVIVGLLLFSDALGPLSSILTFASNKVSRLCEYQADAFAKQ
LGYAKDLGDGLIRIHDDNLSPLEFDSLYTSYYHSHPILVDRLNAIDYTTLKKNN
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtcacctggcctttgcttcctaaaagaaatttcagtcatacaagctacaccaaagcct
actacaagaagttttgccaattgttgtaaaatgggaattctacagcatttgatgcacatt
ttagacattccaggcttcccttggaaaatagtaattgctggattttctattggaaagtat
gcctgggatttgtatcttcgtcgcaggcaagtgccatatttgttgagagaaaagcctcct
gctattttagctgaacacgttgatgaaaaaaagtaccaaaaagcattgtcttatgctcgt
gataaaagttggttttctactattgtttccacatttactttagccgttgatcttttgatt
attaaatatgatggactttcatacctttggaatatcactaagtttccttggatggataaa
ttagctgcttcatcctcaaggtttagtctatcgacttcgattacgcattcctgtgttttc
atgtttggacttactctgttttctcgtttaattcaaattcctttcaatctttactcaacc
tttgtgatcgaggaaaagtatggttttaataaatcgactttaaagatcttcgtaattgat
cttttaaaggaattaagccttggtggtttacttatgagtgttgtcgttggtgttttcgtt
aaaattttgaccaagtttggtgataattttattatgtatgcatggggtgcctatattgtt
tttggcctcattttacaaactattgctccttctctaattatgcccttgttttacaagttt
acaccgcttgaaaatggaagtcttagaacacaaattgaagagttagctgccagtatcaat
tttcccttgaagaagctttatgtgattgatgctagtcgtagatcaactcactccaacgct
ttcttttatgggcttccatggaacaaaggaattgtactttttgatactcttgtgaaaaat
catacggaaccggaacttattgcaattcttggtcacgaacttggtcattggtacatgtct
cataatttaattaatactattatagactacggaatgagtctgttccacctcttcttattt
gctgcttttattcgaaataatagcttatacacttccttcaatttcattaccgaaaaacct
gtaattgttggacttctccttttttcggacgcattaggtcctttatcctccatccttacg
tttgcctccaacaaagtttctcgcctttgtgagtatcaagcggatgcttttgctaaacaa
ttagggtacgcaaaggatttgggtgatggtttaatacgcattcatgatgacaatctttct
cctttggagtttgattctttatatacctcgtattaccatagtcatcccatcttggttgat
cgtttgaatgcaattgattacacgacgctaaaaaagaacaattag

DBGET integrated database retrieval system