KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3H5.08c
Entry
SPAC3H5.08c       CDS       T00076                                 
Name
(RefSeq) WD repeat-containing protein
  KO
K20241  WD repeat-containing protein 44
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC3H5.08c
Membrane trafficking [BR:spo04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    SPAC3H5.08c
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 RNA_pol_3_Rpc31
Other DBs
NCBI-GeneID: 2543641
NCBI-ProteinID: NP_594184
PomBase: SPAC3H5.08c
Ensembl: SPAC3H5.08c
UniProt: Q6LA54
Position
I:3425873..3429364
AA seq 933 aa
MNGNLPHIQIQSPKNSLDHLNNGRQATHNFEHGKPGDREEANGHADAHSSSGRSRYLSSD
TNLLRDGSSSLDPLSKHIMKRTRSEKTLSFLNPSRASSNTHLSREGTNRSSNVTRTVSGR
KSNHGSSLTDTGESDQLSLKSFGAIRQPSQHRSSLFSRMLGSTSHIFGIREDMDNESSEE
ERDGIPRVEGNAADPFSWIPDGKNVWDSPPKYIRVLSHNKKEKSLDHLFLAQELYCKPTL
AATHDRYYEPRATDFPNLAHESSEPSSSRHTADAQSITNASVHLHNSSSPLNRTPSVISD
TLAVAITSNSSSNSSNNAIWAMKFSRDGRYLAVGGQDRILRIWAVLDSEHARSVASETCS
SDPNNPKLNLKAPVFSEAPIREYAGHTADILDLSWSRNNFLLSSSMDKTARLWHPVRKDC
LCCFEHSDFVTSIAFHPKDDRFFLSGSLDCKLRLWSIKEKAVSFWNELPELITAVAFSPD
GGLAIAGTFVGLCLFYDTRGLRFRTQMSIRSSRGKNAKGSKVTGIQTRTQMIDNIAGDTE
MLVTTNDSRIRIYNLRDKSLELKFKGHANAQSQNRAYFDDDGNYVICGSEDHQVFIWDLP
PQHMHKTKKKKHEHFKASVRPITAAVFAPTKTKQLLTLSGDPVYLAAISARRSSVISNAS
IETGPSLRNLKSLSHSYLPIEIMKGHIIVCGDLDGRIRVFRQDSVFAARKLIEKKNIERK
NSETLSNSSFFPQALKAHMNSISSPKRHFSLRHKKNASQITNNENNGNDDIKKGDEPEEE
HVGLRKNSTQEKNANLDPNEALKRADMMMLQEGASSMVYYSLTNLDNPGATVNEAAKTAA
TIEQNEHEIQTSVDPISNVKAILPNADDVSSKNSSTEDQLECLRCGNSLFNVFSRSFVFE
GAKFSIVCSHCNRKLLKSGSDDGSETHEMSTLP
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgaatggaaatctacctcatatacaaattcagtcgccaaagaattcccttgaccacttg
aacaatggtagacaggcgacgcataacttcgaacatggaaaaccgggagacagggaggaa
gcgaacggacatgccgatgctcacagcagctctggacgaagtcgttatttatcatcagac
accaatttattaagagatggttcctctagcttagaccccttgtcgaaacacatcatgaaa
cggactagatctgaaaaaacgctgtcatttttgaatccttcacgggcaagttcgaacacc
catttatcgagagagggaaccaatcgctcttccaacgtaactagaacggtatctggccga
aaaagtaatcatggatcatctttgactgatacaggggaaagcgatcaattgagcttgaaa
agttttggggccatacgtcaacctagccaacatcggtcctctttgttttcgcgcatgctc
ggtagcacttctcatattttcggcattcgagaggatatggacaatgaatcctcggaagaa
gaacgggatggtattcctcgtgttgaaggcaacgccgctgatcccttttcctggattccc
gacggaaaaaatgtgtgggattctcctcccaaatatattcgcgtactctcccacaataaa
aaggagaaatctctcgaccatttgtttttagctcaggaattatactgtaaaccaactctt
gccgcaacacatgaccgatactatgaacctcgtgcaacagatttcccaaatttagctcat
gagtcaagtgaaccttcctcttcacggcatacggctgatgcacaaagtatcaccaatgct
tctgttcacctacataactcgtcgtcacccttgaaccgtacaccatccgtcatttcagat
actttagctgtagctattacatctaactcttcttctaattcatctaataatgcaatctgg
gcaatgaagtttagtcgtgatggccggtatcttgctgtcggtggacaagatcggatttta
cgtatttgggcggttttggattccgaacatgctcgaagcgttgcgtctgagacgtgtagc
tctgatccaaacaatcctaaattaaatttgaaagcacccgtcttttctgaagctcctatt
cgagagtacgctggccatactgctgacattcttgatttatcatggagtagaaataacttt
ctactcagttcttcaatggacaaaacagctcgtctttggcatcctgttcgcaaagattgt
ctttgttgctttgaacactcggactttgtaacgtcaattgcgtttcatcctaaggatgat
aggttctttctgtctggctccttagattgtaaacttcgtctttggtcgattaaggagaag
gccgtttctttttggaatgaattacctgaattaataacagctgtggcatttagccccgat
ggcggcttagccattgctggtacctttgttggcttgtgtttattttacgacacgcgggga
cttagatttcgcactcagatgtctatccgtagttctagagggaagaatgcaaagggaagc
aaagttactggtatacaaacacggactcaaatgattgataatattgcgggcgatacagaa
atgctggtcactactaatgattcgagaattcgcatatacaaccttagagataaaagtttg
gaattgaaattcaaaggacatgcaaatgctcagagtcaaaacagagcctattttgatgat
gatggcaattacgttatatgcggtagcgaagatcatcaggtatttatttgggatcttcct
cctcagcatatgcataaaacgaagaagaaaaagcacgagcactttaaagcatctgtaaga
cctataacagctgcagtatttgctcctacgaaaacaaaacaacttttaaccttatctgga
gatcccgtttatttagctgcgatatctgcaagacgctcttccgtaatttctaacgcttcc
atcgaaacaggtccatcacttcgtaatttgaagtctttatcacatagctatcttcccata
gaaattatgaagggacacataattgtttgtggtgatttagatggtcgaatccgtgttttt
cgacaagatagtgtttttgcagcgcgaaaattgattgaaaaaaaaaatatcgagaggaaa
aatagtgaaactctaagcaactcttccttctttcctcaagctcttaaggcacatatgaat
tcaattagttcccctaaaaggcatttttcacttcggcataagaaaaatgcatcgcagatt
acgaacaacgaaaacaacggaaatgatgatatcaagaagggtgacgaaccagaggaagag
catgtaggtttacggaagaattctactcaagagaagaatgcaaatttggatccaaatgaa
gccctaaagagagctgacatgatgatgttacaggaaggagcatcttcaatggtatactat
tcgcttacaaatttagataatccaggtgccaccgtaaacgaagcagctaagacggctgcc
acgattgagcaaaatgaacacgaaattcagaccagcgttgacccgatatcaaatgtgaaa
gccattttaccgaatgcagatgatgtatctagtaaaaactctagtacagaagatcaatta
gagtgtctccgttgtggtaattccttatttaatgttttttctcgttcctttgtattcgaa
ggcgccaagtttagcatcgtctgctcacattgcaatcgaaagcttttgaaatctggaagt
gatgatggcagcgagactcatgaaatgagtactcttccttaa

DBGET integrated database retrieval system