KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3H5.09c
Entry
SPAC3H5.09c       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Fmp27 Apt1 Fmp27_WPPW Fmp27_GFWDK DUF2405 Fmp27_SW CheZ
Other DBs
NCBI-GeneID: 2543405
NCBI-ProteinID: NP_594183
PomBase: SPAC3H5.09c
UniProt: Q6LA55
Position
I:3416722..3424821
AA seq 2699 aa
MNPLFPFSLLNPSTMWSSSQNTSFVWVVIATGFLFHLVLFVLSYVLGWPFTNFGFFSVYG
LRHTFRNGDSVFISYVALRLHRPSTSKPYLLRIVTKGLIYTPSLSSANDAQSAGKNENQR
SRLVFKAKREEEKTEEKFCHAVYMSNLLRNVEQKWIQFLHKSWMKWLHISIQESQLTFPS
VGTFELGSLSMEMRPETNNVVGYENPSDPELVSSCVICSIRLANLVYIDRRQSSQQITDY
LDLSLQTYYSLDKSNVPDTILRLRSSIKVGVLYIDLDTPLFEHLLNSNSSGGNHSSSSSS
SGKVHVMKDNVEAALLKLQEAQIQIGTLKLWKRNVTGCGATYILNGSDFGLNLILLNKKN
PSHRMFFPVEACVHQILASALSFNVESITPGHSPHVLLNIPLVTITCLTSALAEYARDAS
DLHQLQNSILRVNSTLTSPSLDLRLELLHDVLSCFPKKHDSTSRKKPKFPYQYFPYMKFS
VSLYEPALRFLIASKSDSDFPGMLVANLSSMFLDIKYSPSSEHIFEIESSLRLSSNKVFY
HNPKNKKWLINTSDLITFSLGYICNNDHGSLNMFFRDFQIRIEEEEVINSLKKFIILTKI
KSEQVGPRKPRTKLVEPLLFRIPKWLKHIQLEVHSLLLVITAIRPEISPEPRGINCSIDK
IHSLYLNDKKSRSQGMRKFDLNLELLMIKSIIFKNGKSLNSHLFLQIPNINFIVSTILRD
NTAISRFTTEINFLRCFASLLHNCCIFYAYRACSSLFGENKSHKRIEKTNTSPQEPGVVP
EGWNFDFRLKNARVSIFLDDDVSLLLDCGGFTTLKKTEKKYAEMHAKFIQIHTKNSDVPT
LWDRFLALGNVRYQLKDLSDLEKLHQVTCSYISIRIPHKFIPFILIESAINTVKAAIRVS
AEPLTIDQQHDLAEEIKQPRVVPHIQIKSTKFKFEVDDDPFECRLGMNYRIGLTEQQMRI
DRWNIFEERANLLRKAKDPSPKSASESSSFYQNGSDIDDNDSNSSNTSNHTTENANAQQR
KLEDLNRSFEDFLGSRPTNNSSFLKNVSVDEDTAREKLMEYDSLSWISNIKRIREFRYHR
LRIRRMTAWPESDALDKHILFKENIIPIPIRPPLVDISLLNFDFTLDKPSFPLEELPKFL
NTVGRGQPLDYGYSIYFPMYIDWKMDEAKFLIRDYPLPLVYIPKLGRGQDKRISSWHLKS
NMVITEQQATLAAIRDVSVKVIPADLTKEGIPYVVNVTRTVSPIKTFSKTEIDVNSSLPT
FLLWCNSYQPALSDMTRIMDTFTKMPIDPSEKLGFWDKIRLVAHSQIRLRWLEDGDVFLS
LKGSRDPYVILGEGAGFQFCWSGNVSWDIGCDENPANFMIVDSDKFYLTIPDFPRQINGI
LEGKPLPTKSTKRSYTTFGVLKDLRCRKVIAKLVGKVRWRAGFVPERHCDEDCTVCNRKK
ACRLWNFKPHWQVITRIPQYCHDTHYGVYDAYRDFRSHYIHCSLALESPRYLDDANAFEN
VNSYNTIHLTPLVFSHFSSWWNLFSNNMSYPLRSGNLFPTLDSSPNKKFGRHLATFKYAL
ELTPLFISHMYNYKTNKNWQDRTASATGLKARVDNFTIDLHQRSEKHEVKNKANLGRKHQ
EATSMKVHLAEIDFKTIDLRAISASFDEGALDNSDSIPANVLDEEEKECFSFKNVDGPAN
WVDIDDYHEADWLLPQQNEKCSIYPLAFSPRFTYYRHTKCHRRNEKNEKEIIPDTCRFGD
EFTHRCLMPSRENPKAVQYELLQKRRKELEEFMSSEQERIGFLKSQLESNNDSEEVRQEY
EELTKRIVTLSDHYRLLEYLLKDESSCSQASQCSENGQVDLSYASLSESVHAFNNRFVAH
NVQVKWNNFIRNAVMSYVHEVERVRGFAYYMSQKAIVFLRDLEKRTESANDDFFGNYTED
DEDRENARHLLKFLLEDSKKRFWVKTSDADREHGSEEGNTNSISNNEYDIIQSYVFRFIS
PQIQLQCSSNPEKAVIISIQSLQIKILSVVDPIFPDNDINYLIERRFLCKVNESQFFISK
KSDFEVVNASSLVLNEYGCEHNTVWPPWVPFETTFDFVLTPAAFSRFLHRVSFSVIYTKH
NDLRLQETVHSTRAFFEDLDTHADTLTFDFPRVVFSTDSSQYYDIFTIITDLLLYKEPAQ
KQRNQRLEEIMLAADFSDLTGTSEVVRALQARVHRLLDLKLQHQLYDVTFGIYAHIAQQL
FLQNELHRCGEELYYLIESIAAVQNRGIHQNKVRSNLSWFLMAKEVVWHLLEDNKKPFLD
VRLQNATFRRIENSDASNFNTLEIEFMKGSNLAPGCQFENIICPYFNHEFSNEQLLQQKF
IRIHWEVLEAVAGIQVIQHFEINLFPLSLQIEQELATKLFAYAFPNRNESDGFPHIYSRN
HDKRKENGSQGEADNSNYSGSLMRRRTNDQEEDALATPSSSRRDSRSKRASLIDFTIDKC
LDVDDEGRMELQSMLDRAGSNMLITYFKIPSVVLRLSYRGTGGLGLENITGFVFTVPTME
YRNEVCSYLDLAMKLKHDLIRTVVSHTGKLLVEKVKGNYHLKEHEREVSSELLNLQQLSA
EHNRHADLESMVMARDDYINVQQPLAEENQEEGSPASAISRNHSTRSSLNSPRQFWAYHG
SRSKKIADIVKRHIPPTINGKRSKNKGNEGSNARVDFYNDERYDPVKRELILGASNRRK
NT seq 8100 nt   +upstreamnt  +downstreamnt
atgaacccgttgtttcctttttccttgcttaatccatcaacgatgtggtcgtcctcgcaa
aacacttcattcgtttgggtggtgatagcgacaggtttcctttttcatttggttcttttt
gtactgtcatacgtgctgggatggccctttacaaattttggattcttctccgtgtatggc
ctacgacacacgttccgtaatggagactcggttttcatctcgtatgtggcacttcgtctg
catcgtccttctacttccaagccctatttactgcgcattgtaaccaaaggcttgatttat
actccatcactttccagtgctaatgatgcacaatcggctggtaagaatgagaaccaaaga
tctcgattggtgtttaaagcaaagcgtgaggaagaaaaaacggaggagaaattttgtcat
gccgtttacatgtctaacttacttcgcaatgtggagcaaaaatggattcagtttcttcac
aaatcttggatgaaatggcttcacattagtatccaagaatctcaattgacatttccctct
gtaggaacattcgagttgggcagtctttcgatggaaatgcgtcctgaaaccaataatgtc
gttggatatgaaaatccgtctgatcccgaacttgtatcctcctgcgtaatttgtagcatt
cgcttggcaaacctggtttacattgaccgccggcagagcagtcaacagattaccgattat
ttggacttaagcttacaaacctattactctttagataaatcaaacgttcctgacacgatt
ctgcgtcttcgttcttccatcaaagtgggtgtgttatatatagatctagatactccactt
tttgagcatttgttaaattcaaattcttccggaggaaatcattcttcctcctcctcctcc
tctggaaaagttcatgtgatgaaggataatgttgaagcggccttattaaagttacaggaa
gctcaaatccagatcggtacattgaagctttggaagagaaatgtaacgggatgtggagcc
acctatatcttaaatggtagtgattttggactgaatttgattttactgaacaaaaagaat
ccttcccacagaatgtttttccccgtagaggcatgtgttcatcaaattttagcctctgct
ttgtctttcaacgtcgaaagtatcactcctggccattcaccacacgtgctccttaatatt
cctttggtaactataacgtgtctgacttcagcattggccgagtacgctcgtgatgctagt
gatcttcatcaacttcaaaatagtattttacgagtaaacagtacattgacctctccatca
ttggatcttcgcctagagttgctacacgatgttttgtcttgtttcccaaaaaaacacgat
tcgacttcaagaaagaagccaaagtttccttatcaatacttcccttacatgaaattttct
gtatctttgtacgaacctgctttgcgttttttgattgcatcaaagtccgattccgacttt
cctggaatgctagttgctaatctttcttctatgtttttggacatcaagtattctccatcc
tctgagcatatatttgaaattgagtcttctctacgcttaagctctaacaaagttttttac
cataatccgaaaaacaaaaaatggctaatcaacacatccgacctcattaccttctcatta
ggttatatttgtaataacgatcacggatcgttaaatatgttttttcgtgattttcaaata
cgaattgaagaagaagaggtcattaactcgttgaaaaagtttattattctcacaaagatc
aaatctgaacaagtcggccctcgcaagccacgtaccaaattagtggaaccgcttcttttt
agaatacccaaatggttaaagcatattcaacttgaggttcactcactgctcctagtaatt
accgctattcgccctgaaatttcacctgaacctcgtggtattaattgttctattgacaaa
atacatagtctatatttgaatgataaaaaaagtcgttcacagggtatgcgcaaatttgat
ttgaatcttgagttactcatgattaaatcaattatatttaaaaatgggaaaagtttaaat
agccatttattcttgcaaatccccaacattaactttatcgtgtccacaatccttcgtgat
aatacagccatttcgcgatttactacagagattaattttcttaggtgttttgcatcgttg
ttgcataattgctgtattttttatgcttatcgtgcttgcagttctctatttggggaaaat
aaatctcacaagcgtatagagaagaccaacacttctcctcaggaaccgggtgtggtccca
gaaggatggaattttgattttcgattaaaaaatgctcgcgttagtatttttttagatgac
gacgtttctttattactcgattgcggtgggttcaccactttgaagaaaacggagaaaaaa
tatgctgaaatgcatgcaaagttcatacaaattcatacaaaaaactctgacgtcccgacg
ctgtgggatcggttccttgcacttggcaacgttcgatatcaattgaaggacttatctgat
cttgaaaagctacatcaagtaacctgcagttatatctctatccggattcctcataagttt
atccctttcatattaattgaaagtgccattaacactgttaaagcagcgattagagtatct
gcagagcccttgactattgatcaacagcatgatttggcagaggaaatcaaacaaccaaga
gtagtccctcacatccaaatcaagtcgacaaaatttaagtttgaagttgacgatgatccg
ttcgaatgtcggttaggaatgaattaccgcattggtttaacagaacaacagatgcgtata
gaccggtggaacatctttgaagagcgagcaaatttacttcgtaaagctaaagatccgtct
cctaaatctgcatctgaatcgtcttcattttaccaaaacggttctgatatagatgataat
gatagcaactcgagtaatacatcaaatcatacgacagaaaatgcaaatgcacaacaaaga
aagcttgaagatttaaatcgaagcttcgaagactttttgggcagccgtcctacaaataat
tcttcgttcctaaaaaacgtttcggtagatgaagatacagctcgggagaaattaatggag
tatgactccttatcatggatctcaaacataaaacggattagggagtttagatatcatcgt
cttcgtattcgtcgaatgactgcttggccagaatccgatgctttggataagcacattttg
ttcaaagaaaatattattccaattcctattcgcccacctttagttgacatttcacttttg
aattttgattttacattagacaagccatcttttccattggaagaactccccaaatttttg
aatacggttggcagaggccagccacttgactatggttattcgatttatttccctatgtac
atcgattggaaaatggatgaagctaaattcttgattagagactatccactgcctttggta
tatattccaaagttgggacgtggacaggataagcgtatatcttcttggcacttaaaaagt
aatatggtcattacggaacagcaggctactttggctgccatacgtgatgtcagtgtaaag
gtaatcccagcagacttaacaaaagagggtattccatacgttgttaatgttacacgtacc
gtatctccaatcaaaactttttctaaaactgaaattgatgttaattcttccctcccaact
tttctgctttggtgtaattcatatcaaccagctttatctgatatgacacgaattatggat
acattcacaaaaatgccgattgatccttcagagaagttgggtttttgggataaaatcaga
cttgtcgctcattctcagatacgtctacgttggcttgaagacggtgatgtttttctttct
ttaaaaggttcacgagatccttatgttattctaggtgaaggtgcaggtttccaattttgt
tggtcgggaaatgtttcctgggacattggttgtgatgagaatcctgctaattttatgata
gttgacagtgataaattctatttgaccattcctgattttccccgccaaataaacggtatt
ctagagggaaaacctcttcctacaaagtctacaaagcgttcatataccacttttggtgtg
cttaaagatttacgttgtcgaaaagtgattgccaaactcgtaggtaaagtacgttggaga
gctgggtttgtacccgaaaggcattgtgacgaagattgtactgtttgcaatagaaagaaa
gcttgccggttgtggaatttcaaaccacactggcaagtaatcactagaatccctcaatat
tgtcatgatactcattatggtgtatatgatgcctatcgtgattttcggagccattatata
cattgctcacttgctttagagtctccaagatacctagatgatgcgaatgcttttgaaaat
gtgaattcttataacactattcatctaacaccgcttgtgttttcccactttagttcttgg
tggaatttattttcgaacaacatgtcttatccattacgcagtggtaatctttttcctact
ttagattcatcccctaacaaaaagtttggccgacatttggctacttttaaatatgcgcta
gagcttacgcctctttttattagccatatgtacaactacaaaaccaacaaaaattggcag
gatagaactgcgagcgctactggtttgaaagctagagttgataacttcacaattgattta
catcagcgttctgaaaagcatgaagtaaaaaacaaagcaaatttaggaagaaagcaccaa
gaagccacatcaatgaaagttcatcttgctgaaattgatttcaagactatcgacttaaga
gcaatttctgcttcttttgatgaaggggcccttgataattcagactctataccagctaac
gtgctggatgaggaggaaaaagaatgtttttctttcaaaaatgtagatggtcctgctaat
tgggtcgatattgatgactatcacgaagcagattggcttttacctcagcagaatgagaaa
tgctccatctatcctctagcgttttctccaagatttacttattatcgtcataccaaatgc
caccgtcgaaatgaaaaaaacgaaaaggagataattcctgatacgtgcagatttggagat
gaatttactcatcgatgtttaatgccaagtagggaaaatccgaaggcggtccaatatgaa
cttcttcaaaaacgccgaaaagaacttgaagaattcatgagttctgagcaagagcgaatt
ggttttcttaaatctcagttggaatccaataacgattccgaggaggtcagacaagaatac
gaagaacttactaaaaggatagtaactttatctgatcactatcgcttattggagtatcta
cttaaagatgaaagtagttgtagtcaagcgtcacaatgttcggaaaatgggcaagtggat
ctttcttatgcgtcattatcggaatccgttcatgccttcaacaatagatttgttgctcat
aatgtccaagttaaatggaacaatttcattcgaaatgccgttatgtcttatgttcatgaa
gttgaacgtgtaagaggatttgcttattacatgtcacagaaggccatcgtttttttgcgt
gatttagaaaaacgtactgagtctgctaatgatgacttttttggaaattacaccgaggat
gatgaggaccgagaaaatgctagacatttgttaaagtttttacttgaagactctaagaag
aggttttgggtaaagacttctgacgctgatcgtgaacatggtagtgaagaaggtaacaca
aactccatcagtaataatgagtatgatattattcaaagttatgttttccgatttatttcc
cctcaaattcaattacagtgtagctccaatccggagaaagctgtaataatatcaatccaa
agcttacaaattaaaattctaagcgtcgttgacccaatttttcctgataatgatatcaat
tatcttatagagagaagattcttatgtaaagtgaatgagtcccagttttttatttctaaa
aaatccgacttcgaagttgttaatgcttcaagtcttgttttgaatgaatacggatgtgaa
cataatacagtttggcctccttgggttccatttgaaaccacatttgatttcgtgcttact
cctgctgctttctctcgttttttgcatcgggtatccttttcggtaatttacacaaaacac
aatgatttacgtttacaagaaacggttcattcgactagagccttttttgaggatttagat
actcacgctgatacgttaacctttgattttcctcgggttgtcttttctactgactcgtct
cagtattatgatatttttacaattataactgatttgttgctgtataaagaaccagcccaa
aaacaacgtaatcaacgtttagaggaaattatgcttgctgctgattttagtgacctgaca
ggtacttcggaggtagttagagctttacaagcaagagttcatcgtctgttggatctaaag
ctacagcaccaactatatgacgtgacgtttggtatatatgctcatatcgcacagcagttg
tttttgcaaaatgaattacaccgttgtggagaggagttgtattatttaattgagtcgata
gccgctgttcagaaccgtggaatacatcaaaataaagttaggtctaacttgagttggttt
ttgatggcaaaagaggttgtatggcaccttttagaagacaataaaaaaccatttctcgat
gtccgtttgcaaaatgccacttttcggcgtattgaaaattcggacgcatctaattttaat
acacttgagatagagtttatgaaaggttctaatctggcgccaggctgccaatttgagaac
ataatttgtccatactttaatcatgaattctctaacgagcaactgcttcaacagaaattt
atacgcattcactgggaagtactagaggcggtcgcaggtattcaagtgattcagcatttt
gaaattaatttgtttccattgagtttgcaaattgaacaggaattggctactaagctcttt
gcatatgcgtttccaaatcgcaacgaatccgatggatttccacatatatattctcgtaat
catgacaaaaggaaggaaaatggatcccaaggtgaagcggataattcaaattactctggt
tcattaatgcggcgtcgcacaaatgaccaagaagaagacgctttagctactcctagttca
tcaaggcgggatagtcgctcgaaacgagcatcgttaattgactttactattgacaaatgc
cttgacgtagacgatgaaggcagaatggaacttcagtcaatgttagaccgcgctggctca
aatatgcttatcacgtacttcaagattccaagcgtcgtccttcgtttgagttatcgtgga
acgggaggcttaggtttggaaaatattactggatttgtgtttaccgtccccactatggaa
tatcgaaatgaagtatgctcttacttggacttggctatgaagttgaagcacgatcttata
cgaacagtagtttcccatactggaaagctacttgttgagaaagtaaaaggcaattatcat
cttaaggaacatgaacgtgaggtttcttcagaactcttaaaccttcaacaactctcagcc
gaacataatcgacatgcagatttagaaagcatggttatggctcgagatgattacataaat
gtgcagcaacctttggccgaggagaatcaggaagaaggttcaccggcgtctgcgataagc
agaaaccacagcactcgttcatcattgaattcaccgcgtcagttttgggcttatcatgga
tcgagaagtaaaaaaatcgccgatattgtcaaaagacatatacctccaacaattaatgga
aagagaagcaaaaataagggcaatgaaggatcgaatgctagggtcgatttttacaacgat
gaacgttatgatcccgtcaaacgtgaattgattcttggagcttctaatcgccgaaaatag

DBGET integrated database retrieval system