KEGG   Schizosaccharomyces pombe (fission yeast): SPAC3H8.09c
Entry
SPAC3H8.09c       CDS       T00076                                 

Gene name
nab3
Definition
(RefSeq) putative poly(A)-binding protein Nab3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: RRM_1 RRM_5
Other DBs
NCBI-GeneID: 2543638
NCBI-ProteinID: NP_593002
PomBase: SPAC3H8.09c
UniProt: Q10145
Position
I:complement(join(604496..604959,605015..605355,605438..606849))
AA seq 738 aa
MSSSSKDSSFQVETPVQNILETSTNSELQDQVSSPYEPDYNSPVKQAAASISALQTQDDT
LFNNVDERTLENKDGNKSDDANFDQVSGIPSGSLEIPILNSATSNIRLTPSDTYNNIPVS
DTNNEEISKNIYGAPILESTSSDFQSKDSLSTTQPSVSGGNGSTSQSPPSLDVEQNKPFS
ISNEPVEQETENSSTKDLQVYDFQTASEHLPEQSLQNTTYYDPSKTYSSVNFEEIEYGKS
HEKLDLPYRTTDFIPYSKDLSTSPEAHRTSIYSYSANLPNYYNEHNELHEHHNPQTPSSP
ESAYSPENLQLNHEAQNVEYLGNNAAEKSLQMNLEDEQRFQQFLKDEESIMSNWYPGQFP
SASRLFLGHLNTKSLSKRNLWKVFKIYGPLAQIVLKANYGFVQFFTNEDCARALNAEQGN
FVRGQKLHLEISKIQKKYQNQIENMKKGSHVTKSNQYSEMIGNLPYPTSSRKRTRSPLMS
KGKSYDRKGSISMSKNFSPDCEILVTEDCPKEFVWGVEKVFQERRLNIHTTCLYRDSNLQ
VIIKSCIINSVKSIILINAGLAHLGKVSVQVFKDGSSDSEVRCDEYAAVDVMVAASIVHH
AKTSLMHSAASSTPSYNGERIVPDVPSPCISTNPNLPALVGSLDSVNLHHLLGFIQNTYS
TTSYIPTRVSFNPNDTGGSFGTITSQSQFVVNEMPKNYARDNYEALHSQESRQRSSVAGN
KQLQKILEQLAELKQPDF
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgtcatcctcgtctaaagattcttcgttccaagtggaaactcctgtgcagaatatttta
gaaaccagtacaaactccgagcttcaagaccaggtatcatctccatatgaaccagactac
aactcacctgtcaaacaggctgctgcttcgataagtgctttacaaacacaagacgacact
ttattcaacaacgttgatgaacgtacattagaaaataaggatgggaataagtcagatgat
gcaaactttgatcaagtatccggtattccttctggaagtttggagataccaatattaaac
tcagctactagcaacattcggttaactccttcagatacttataataatattccagtttcg
gacaccaacaatgaggaaatttctaaaaacatatatggagctccaattttagagtcaact
tcttccgactttcaaagtaaggattcactttccactactcaaccaagtgtttcgggggga
aacggatctacctctcaaagtcctccttcactcgacgttgagcaaaataagcctttttcg
atatccaatgaaccagtggaacaagaaactgaaaactcttctactaaagatttacaagta
tacgattttcagaccgcttcagagcatttacctgaacaatccttacaaaacaccacttat
tatgatccgtcaaaaacttatagctcggtgaattttgaagaaattgaatatggaaagtct
catgagaaattagatttaccttatagaactactgattttattccctattctaaagacttg
tcaactagtcctgaggctcacaggactagtatttattcgtatagtgctaatttgcccaat
tattataatgagcataatgaattacatgaacatcataatccccagacacccagttccccg
gaatctgcgtatagtcctgaaaatttgcaacttaatcatgaagcacaaaatgttgaatat
ttgggtaacaatgctgccgagaaatcgttgcaaatgaacttagaggatgaacaaagattt
caacaatttttgaaagatgaagaaagtataatgtcaaactggtatccagggcaatttcct
tcagcttctcgcttatttttgggtcatctaaatacaaagagcttatctaaacgaaatttg
tggaaagtttttaaaatttatgggcctttagcacagatagttttaaaagcaaattatggt
ttcgttcagttttttacaaacgaagattgtgctagggctttaaatgcggaacaaggcaat
tttgttcggggtcaaaagctgcatttggaaatttctaaaattcagaagaaatatcaaaat
caaatagaaaacatgaagaaaggatcacatgttaccaaaagtaatcaatattctgaaatg
attggaaaccttccttatcccactagtagcagaaaacgcacgcgatctcctttaatgtcg
aagggtaaatcctacgatagaaagggatctatatccatgtctaaaaacttcagccctgat
tgtgaaatactagtcacggaagactgtccaaaggaatttgtatggggagtggaaaaagtc
tttcaggagcgtcgattgaatatacataccacttgtttgtaccgtgactcaaacttacaa
gtcattattaaaagctgtattattaacagcgttaaatccattatcttgataaacgccggt
ttggctcacctagggaaggtgtcggttcaagtgtttaaagacggatctagcgattcagaa
gtccgttgtgatgaatatgctgctgtggacgtgatggttgctgcaagtattgttcaccac
gcaaagacttctctcatgcactcagctgcttctagtacgccatcgtataatggtgagcgt
attgtgcctgacgtgccatctccctgtatatcaacgaatcctaatctaccagctttagta
ggttctttagattctgttaatcttcaccatttattaggattcattcaaaatacctatagc
actacttcatacattccaactagagttagttttaatcctaatgataccggaggatcattt
ggaacaattacatctcagtcccaatttgttgtgaatgagatgcctaaaaattatgctcgt
gataattacgaagcattgcattctcaagaaagccgccaaaggtcttcagttgctggaaac
aagcaacttcaaaagatattagagcagctcgcagagctcaagcaacctgatttttga

DBGET integrated database retrieval system