KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4A8.11c
Entry
SPAC4A8.11c       CDS       T00076                                 

Gene name
fas2
Definition
(RefSeq) fatty acid synthase alpha subunit Lsd1
  KO
K00667  fatty acid synthase subunit alpha, fungi type [EC:2.3.1.86]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00061  Fatty acid biosynthesis
spo01100  Metabolic pathways
spo01212  Fatty acid metabolism
Module
spo_M00082  Fatty acid biosynthesis, initiation
spo_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SPAC4A8.11c (fas2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:spo01004]
    SPAC4A8.11c (fas2)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.86  fatty-acyl-CoA synthase system
     SPAC4A8.11c (fas2)
Lipid biosynthesis proteins [BR:spo01004]
 Fatty acid synthase
  Yeast type
   SPAC4A8.11c (fas2)
SSDB
Motif
Pfam: FAS_I_H Fas_alpha_ACP ketoacyl-synt ACPS Ketoacyl-synt_C adh_short adh_short_C2 F420_oxidored SH3_10 PP-binding GDP_Man_Dehyd KR CAP_N
Other DBs
NCBI-GeneID: 2543618
NCBI-ProteinID: NP_593823
PomBase: SPAC4A8.11c
UniProt: Q10289
Position
I:complement(2567040..2572568)
AA seq 1842 aa
MRPEVEQELAHTLLLELLAYQFASPVRWIETQDVILSPPVSAERIVEIGPSPTLAGMAKR
TLKLKYENMDAALSINREVLCYSKDAREIYYNFEDEVADEPAEAPASTSSTPKVETAAAA
APAATPAPAPAQTSAPAAALPDEPPKALEVLHTLVAQKLKKSIEEVSPQKSIKDLVGGKS
TLQNEILGDLQKEFGATPEKPEEVPLDELGAIMQSSFNGSLGKQSSSLISRMISSKMPGG
FNNSAVRGYLGNRYGLGPGRLESVLLLALTMEPASRLGSEADAKAWLDSVAQKYAARNGV
TLSSPTAEGGSSSGSAAVIDEETFKKLTKNNTMLVTQQLELFARYLNKDLRAGQKAQVAE
KVISDTLRAQLDLWNEEHGEFYASGIAPIFSPLKARVYDSDWNWARQDALKMFFDIIFGR
LKHVDTEIVARCISVMNRSNPTLLEFMQYHIDHCPAEKGETYQLAKTLGQQLIDNCKSVI
DAPPVFKNVNHPTAPSTTIDERGNLNYEEIPRPGVRKLTHYVTEMAKGGKLPTESKNKAK
VQNDLARIYRIIKSQNKMSRSSKLQIKQLYGQVLHALSLPLPSSNDEQTPVKETIPFLHI
RKKSVDGNWEFNKSLTGTYLDVLESGAKNGITYQDKYALVTGAGAGSIGAQIVEGLLAGG
AKVVVTTSRFSRKVTEFYQSLYTRHGSRGSCLIVVPFNQGSKTDVEALIDYIYDEKKGLG
WNLDYIVPFAAIPENGREIDGIDSRSEFAHRIMLTNILRLLGAVKSQKASRGMDTRPAQV
ILPLSPNHGTFGNDGLYSESKLGLETLFNRWYSESWANYLTICGAVIGWTRGTGLMAPNN
IVSQGIEKYGVRTFSQSEMAFNILGLMSQKVVDLCQSEPIYANLNGGLELLPDLKDLSTR
LRTELLETAEIRRAVAAETAFDHSITNGPDSEAVFQKTAIQPRANLKFNFPKLKPYEALS
HLSDLRGMVDLEKVPVVTGFSEVGPWGNSRTRWDMECYGEFSLEGCVEIAWIMGLIKNFN
GKGKDGKPYSGWVDTKTGEPVDDKDVKAKYEKYILEHCGIRIIEAELFHGYNPEKKELLQ
EVVIDHDLEPFEASKEAAHEFKLRHGDQVEIFEIPDSTEWSVRFKRGTSMLIPKALRFDR
FVAGQIPLGWDPKRYGIPDDIISQVDPTTLYVLVSTVEALVASGITDPYECYKYIHVSEL
GNTVGSGIGGMSALRGMYKDRWTDKPVQKDILQESFINTANAWINMLLLSASGPIKTPVG
ACATAVESVDAAVDLITSGKARICISGGYDDFSEEGSYEFANMGATSNAAKETERGRTPQ
EMSRPATSTRDGFMESQGAGVQIIMQAKLAIEMGVPIHGIVGYVSTAMDKQGRSVPAPGQ
GILTGAREIATKTPLPIVDLKFRSRQLQRRRSQIGEWAEREYLYLEEELDAMKVQNPDLD
LEAYRIERINVIKEEVVRQEKEALNTFGNEFWKRDPTIAPIRGALAVWGLTIDDLGVASF
HGTSTKANEKNECDVIDSQLTHLGRSKGNAVYGVFQKYLTGHSKGGAGAWMLNGALQILR
SGFVPGNRNADNIDEYLARFDRVMFPSEGIQTDGIKAASVTAFGFGQVGGQVIVIHPDYI
YGVIDEATYNAYKAKTAARYKASYRYTHDALVYNNLVRAKDSPPYTKEQEKAVYLNPLAR
ASKSKAGTWTFPATLPAESDISKTNETTRTLQSLTTSLTNSNENVGVDVELVSAISIDNE
TFIERNFTDTERKYCFAAPNPQASFAGRWSAKEAVFKSLGISGKGAAAPLKDIEIISSES
GAPEVVLHGEAAKAATTAGVKSVSVSISHDDNQSVSVALAHK
NT seq 5529 nt   +upstreamnt  +downstreamnt
atgagaccagaagttgagcaggagcttgctcatactttattattggagttgcttgcatac
cagtttgcatctcctgtccgttggattgagacgcaagatgtaattctttctcctccagta
tcggctgaacgtatcgtcgaaattggacctagtcctaccttagctggtatggctaagcgt
accttgaaattgaaatatgagaacatggatgccgctttaagtattaatcgtgaagttctt
tgctactctaaagatgctcgtgaaatctattacaactttgaggacgaggttgctgatgaa
cctgccgaagccccagcttcaaccagctccactccaaaggttgaaactgctgctgctgcc
gctcccgctgccacgccagcccctgccccagcacaaacatcagccccagctgctgcttta
cctgacgagcctcccaaagctcttgaggtacttcatactcttgttgcccaaaagttgaag
aaaagcatcgaggaagtctcccctcaaaaatctatcaaagatttggttggcggtaagtcc
actttgcaaaacgaaattcttggtgatttacagaaggagttcggtgccactcccgagaag
ccagaggaggttccattggatgagcttggagctatcatgcagtcaagctttaacggatct
cttggtaaacaatcgtcttctcttatctcacgaatgatttcctcaaaaatgcctggtggt
ttcaataattctgctgttcgtggttatttaggaaaccgttatggtttgggtcctggtcgt
ttggagtctgtgcttttgttagcgcttaccatggaacctgcatcacgtttgggctcggaa
gctgatgctaaagcttggcttgatagtgtagctcaaaaatatgctgctcgtaatggtgtt
acattatcttctcctactgctgaaggcggttcttcgtccggttctgcagctgttatcgat
gaagaaacctttaagaaactcaccaagaataataccatgcttgttactcagcaattagaa
ctatttgctcgatacctcaataaagaccttcgtgctggccaaaaggctcaagttgctgaa
aaggttatttccgataccttacgcgctcaattagatttatggaacgaagaacatggtgaa
ttttatgcatcaggaattgctcctattttttcgcctttaaaagctcgcgtttacgactcc
gactggaattgggctcgtcaagatgctcttaagatgttttttgacattatctttggtcgt
cttaagcatgttgatactgaaatagtcgctcgttgtatttctgttatgaatagatccaac
cctactttacttgaatttatgcaatatcatattgatcattgtcccgccgaaaagggtgaa
acatatcaacttgctaaaaccttgggccaacagctaattgataattgcaaatccgtgata
gatgctcctccagttttcaaaaatgtgaatcatccaactgctccttctacgacgattgac
gaacgtggtaatttgaattatgaagaaatccctagaccaggtgttcgcaaattaactcat
tacgttactgagatggccaaaggtggtaaattaccaacggagtccaaaaacaaagctaag
gtacaaaacgatttggctcgaatttatcgcattattaagtctcaaaacaaaatgtctcgt
tcgtctaagttgcagattaaacagttgtacggtcaggttttacatgccctttcccttcca
ttgccttcttccaacgatgaacaaacgcctgttaaagaaaccattcctttccttcatatt
aggaagaagtccgttgatggtaattgggaattcaacaagtcattgactggcacttattta
gatgttttagaatcgggtgctaagaatggtataacataccaagacaaatatgctctagtg
actggtgcaggtgcaggctccattggtgctcagattgttgaaggtctccttgctggtggt
gctaaagttgtagttactacatcccggttttcgcgcaaggttactgaattttatcaatcc
ctttacacccgccatggaagccgtggttcatgtctgatcgtggttccatttaaccaagga
tctaagacagacgtagaagctcttattgattatatttatgacgaaaagaagggtcttgga
tggaacttggactacattgttcctttcgctgccattccagaaaatggtcgtgaaattgat
ggcattgattctcgttccgagtttgctcaccgtattatgttgacaaacattttgagactg
cttggcgccgtcaaaagtcaaaaggcctctcgtggtatggatacccgacccgctcaagtt
attttgcctctttctcccaatcacggtacctttggaaacgatggtttatactcggaatct
aagttaggtttagaaactttgtttaaccgttggtactccgagtcatgggctaattaccta
accatttgtggggctgtcattggttggactcgtggtacaggcttaatggcacctaataat
attgtttctcagggaatcgaaaaatatggtgttcgtactttttcgcagagtgagatggct
tttaacattttgggtttgatgtcccagaaagtcgtcgacttgtgtcaatctgaaccaatt
tatgccaaccttaacggtggtcttgagcttttacctgatctcaaggacctttccactcgt
ttgcgtaccgaattgttagaaactgccgaaatccgccgcgctgttgccgcagagactgcc
tttgatcatagcattaccaacggacctgactctgaagcagttttccagaaaactgccatt
cagcctagggccaatcttaaatttaatttccccaaattgaaaccttatgaagccctttct
catttatctgatcttcgtggaatggttgatttagaaaaagttcctgttgttactggtttt
tccgaagtaggtccatggggtaactctcgtactagatgggatatggagtgttatggtgag
ttttcactagaaggatgtgtcgaaattgcttggattatgggattaattaaaaacttcaat
ggcaagggcaaagacggcaagccctattcaggttgggttgatacaaagaccggtgaacct
gtggacgacaaagacgttaaagctaagtatgagaagtatatactggagcattgcggtatc
cgtattattgaagctgaactcttccatggatataatcctgaaaagaaagagcttttgcaa
gaagttgttattgatcatgacttagagccttttgaagcatccaaagaggctgctcatgag
ttcaagcttcgtcatggtgatcaagttgaaatttttgaaattcctgattctaccgaatgg
tccgtacgcttcaagcgcggtacaagtatgctaattcctaaggctttgcgctttgatcga
tttgttgctggccagattccacttggttgggatcccaaacgttatggcattcctgacgat
attatttctcaagttgaccctacaactttgtacgttttagtgtctactgtagaagctctg
gttgcatcaggtattacagatccttatgaatgctataagtatattcacgtatctgaactt
ggtaatacagttggttctggtattggtggtatgtctgctcttcgtggaatgtacaaggac
cgctggactgataaacctgttcaaaaagatattttacaagaatcattcattaacactgcc
aatgcttggattaacatgcttttgctctctgcctctggtcctattaagactcctgttggt
gcttgcgctaccgctgtcgaatctgttgatgcagctgtcgacttgatcacttctggtaag
gccaggatatgtattagcggtggttatgacgacttttcagaagaaggttcatacgagttt
gcgaacatgggtgctacatcaaatgctgctaaggaaacagaaaggggacgtactcctcaa
gaaatgtctcgtcctgctacttctactcgtgatggatttatggagtctcaaggtgctggt
gtacagattatcatgcaagcaaagcttgctattgagatgggtgtccctatacatggtatt
gttggttatgtttccacagctatggataaacaaggtcgttcggttcctgcccctgggcaa
ggtattttgactggtgctcgtgaaatcgcgactaagacaccccttcccatagttgacctt
aaattccgttctcgtcaactccaacgccgccgttctcaaattggtgaatgggccgaacgc
gagtatctttatttagaagaagaacttgatgcgatgaaggttcaaaatcctgacttggat
ttagaggcttaccgtatagagcgtatcaacgttattaaggaggaggttgttcgacaagaa
aaggaggcgctcaatacttttggaaatgaattttggaaacgtgatcctactattgctcct
atccgtggtgcattagctgtttggggtcttactattgacgatttgggcgttgcatcattc
catggtacctctaccaaagccaatgagaagaatgaatgcgatgtcattgacagtcagtta
acacatctcggacgctctaagggtaacgctgtgtacggtgttttccagaaatatctcact
ggacatagcaagggtggtgctggagcttggatgctcaacggagctctccaaattcttcgc
tctgggtttgttccgggtaatcgtaacgccgataacattgatgagtatctagcacgattc
gaccgggttatgttccctagtgaaggtatacaaactgatggcataaaggcagcatctgtt
actgcatttggttttggacaagttggtggacaagttatagttatccatcctgattacatt
tacggtgtgattgatgaggctacttataatgcttacaaagctaaaactgctgctcgttat
aaggcatcttatcgttacacccacgatgcgctggtttacaacaatttggtccgcgccaag
gattctcctccttacaccaaagaacaagagaaagccgtttatctcaatcctttggcacgc
gcttcgaagagcaaagctggcacttggactttccctgccacactgcctgctgaatccgac
atttctaaaaccaacgaaactacacgtactctacaaagcctaacaacctcattgaccaac
tccaatgaaaatgttggcgtggatgttgaacttgtatcagcgattagcattgataatgag
acctttatagaaaggaattttactgataccgagcgaaagtactgttttgcagctcctaat
ccccaagctagctttgccggacgttggtcagccaaagaggctgtctttaagtctttgggt
atttccggtaaaggcgctgcagctccattgaaggatatcgaaattatttcttcagagtct
ggtgctcctgaagtagttttgcacggagaggctgcgaaggctgcaacgaccgccggtgtg
aagagtgtttccgtcagtatttcccacgatgataatcaaagtgtcagtgttgctttggct
cacaagtaa

DBGET integrated database retrieval system