KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4C5.03
Entry
SPAC4C5.03        CDS       T00076                                 

Definition
(RefSeq) CTNS domain protein (SMART)
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: PQ-loop CcmH DUF2681
Other DBs
NCBI-GeneID: 2543590
NCBI-ProteinID: NP_593250
PomBase: SPAC4C5.03
UniProt: O14166
Position
I:1196995..1197903
AA seq 302 aa
MEFSTSSFIFDDDTPPKCPLATKASFIFSVYIIIGLIISYLLQIFRIVRLGSSQGLSFSY
LILGYIGVLNAFSNVIALQISPLTECCQNYYSKKQCFANTTGLIQVGSQVLIMGCVLMAF
WMFLPRPIHFVAADDENGLPIPEPLSVTKSRKWRKASYGLLGVFTWGLFIICLSATVLSS
NFAWAAFLGFSASFCAVVQYVPQIIKTIRHQSHGALSIPMMMMQTPGGFLIGYLLSRLPG
TNWTTYMMYIVSACLQGLLLMLCMFYLHKEKSRRKREELQATLQEEESQRAVRILEAETG
PE
NT seq 909 nt   +upstreamnt  +downstreamnt
atggagtttagcacgagcagtttcatttttgatgatgatacaccaccgaagtgccctttg
gcaacaaaagctagctttatcttttcagtgtatattatcataggcctcatcatttcttac
ctgttacaaatctttcgcattgttcgtctcggaagttcgcaaggcttaagtttttcttac
cttattttgggttacataggtgttcttaatgcgttctcaaatgtcattgctctacaaatt
agccctttaactgaatgctgtcaaaattactattccaaaaagcaatgctttgctaacaca
accggtttaattcaagtgggttctcaggtacttattatgggttgtgttcttatggctttc
tggatgtttctccctcgacctattcactttgttgcagcagatgacgaaaatggtttacca
atccctgagcctttaagtgtaacgaaaagtcgtaaatggcgaaaagcatcttatgggcta
cttggtgtatttacttggggattgtttatcatctgtctatccgcaaccgtccttagttcg
aactttgcttgggcagcattccttggatttagcgcttcattctgcgcggtcgttcagtat
gttcctcaaatcataaaaactatacgccatcaaagccatggtgcccttagtatcccaatg
atgatgatgcaaactccgggtggatttttgatcggatatttactatccaggttgcccggt
actaattggactacgtacatgatgtatattgtcagcgcatgccttcaaggattgttatta
atgctttgcatgttttatttgcacaaagaaaaaagtagaagaaagagggaggaattgcag
gccactttacaggaagaagaaagtcagcgagctgtacgaattttggaagccgaaactggt
cccgaataa

DBGET integrated database retrieval system