KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4C5.04
Entry
SPAC4C5.04        CDS       T00076                                 

Gene name
rad31
Definition
(RefSeq) SUMO E1-like activator enzyme Rad31
  KO
K10684  ubiquitin-like 1-activating enzyme E1 A [EC:6.2.1.45]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPAC4C5.04 (rad31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:spo04121]
    SPAC4C5.04 (rad31)
Enzymes [BR:spo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     SPAC4C5.04 (rad31)
Ubiquitin system [BR:spo04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   SPAC4C5.04 (rad31)
SSDB
Motif
Pfam: ThiF
Other DBs
NCBI-GeneID: 2543606
NCBI-ProteinID: NP_593251
PomBase: SPAC4C5.04
UniProt: P79064
Position
I:join(1198459..1198541,1198592..1199020,1199074..1199219,1199298..1199397,1199454..1199619)
AA seq 307 aa
MGNHNINAEEIALYDRQIRLWGFNAQQALKQSRVLLITASPLANEIAKNLVLSGIGKLCV
LDSMTVYEKDVEEQFFIEASDIGQLRANVFKKKLHELNPLVEIDTDTSLISEIDEGKISK
FSMVIATQLDYEEFCRINELTRICNASFYATSCFGLYGFAFCDLINHNFAIDRVVDNTKV
EEDMFIVQKPMKEAFQSILGETLKPRLAKKIPTLYPAMLSLLKSKKSDPDSIRQVCIEQK
LNEKTVLNGEFLSKFSSNISFQWTPVMSVVGGVVSQDALNSISKKQFPIDNFWIFDAESG
LAPIYRL
NT seq 924 nt   +upstreamnt  +downstreamnt
atggggaatcacaatattaatgctgaagaaatagctttatacgatagacagattaggctc
tggggctttaatgctcaacaagcactaaagcaatcccgcgtcctattaataactgcttct
ccattagcgaatgaaatagcgaaaaacctggtattatctggaataggaaaactttgtgta
ttagattcaatgactgtttatgaaaaggatgtcgaggagcaattttttatagaagcttca
gacattggccagctccgcgctaatgtcttcaagaaaaagttacatgaattaaacccttta
gtagaaattgatacagatacgtctctgatatctgaaattgacgaaggaaaaatctcaaag
ttcagcatggttattgcgacgcaacttgattatgaagagttctgccgaataaacgaatta
acccgaatttgtaatgccagtttctacgcaactagctgttttggtctttatgggttcgct
ttttgtgatttgattaaccacaattttgcaattgatcgagtcgttgataatactaaagta
gaagaggatatgtttattgttcaaaaacccatgaaggaagcctttcaaagcatattgggc
gaaacactaaaacccaggttagcaaaaaagattcctacattatatccagcgatgttatct
ttattaaaaagtaaaaaatcagatcctgactcgattcgacaagtttgcatcgagcaaaag
ctgaacgagaaaacagtactaaatggagaatttttatcaaaattttcttccaatatcagc
tttcaatggactccggttatgtccgttgttggcggggttgtttcacaagatgcattgaat
tcaattagcaagaagcagttccccattgataatttctggatttttgatgccgaatcaggc
cttgctccaatttatcgtttgtaa

DBGET integrated database retrieval system