KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4D7.04c
Entry
SPAC4D7.04c       CDS       T00076                                 

Name
(RefSeq) putative cis-prenyltransferase
  KO
K11778  ditrans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.87]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00900  Terpenoid backbone biosynthesis
spo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPAC4D7.04c
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:spo01006]
    SPAC4D7.04c
Enzymes [BR:spo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.87  ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific]
     SPAC4D7.04c
Prenyltransferases [BR:spo01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SPAC4D7.04c
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-GeneID: 2543620
NCBI-ProteinID: NP_594957
PomBase: SPAC4D7.04c
UniProt: O14171
Position
I:complement(join(5357392..5357502,5357558..5357774,5357821..5358080,5358193..5358399))
AA seq 264 aa
MGNLSGWFIHCPPLQWTLDQLETMMINTIKRGKVPQHIAFVMDGNRRWARQRRMETIEGH
SSGFEALKSLLKVCLKLGVKEVSAFTFSIENFKRSKYEVDMLMEIAKNSLTQITAHGDLV
DQYGIRIRIVGDLSRLQPDVLETALKAVEITKHNTKATLNVCFPYTSRHEIATSVQSIVK
MAEDGTITPEDIDEDIFEKNLLIKDSLPLDLLIRTSGVERLSDFMLWQCHKNTEIKFIDF
YWPDFSIWKFFPMLIQYQLQNQPA
NT seq 795 nt   +upstreamnt  +downstreamnt
atgggtaatttatcaggctggtttattcactgtcctccattacaatggacacttgatcaa
ttagaaacgatgatgataaatacaattaaacgtggcaaagtaccacaacacatagccttt
gtaatggatggcaatcgacggtgggctcgtcaaagaaggatggaaactatcgagggtcat
agctcaggttttgaagctttaaaatctctattaaaagtgtgtctgaagttaggagttaaa
gaagtatcggctttcacattctccattgaaaattttaagcgatctaaatatgaagttgat
atgttaatggagattgcaaaaaacagcttaacgcaaattactgctcatggtgatttggtt
gatcagtatgggatccgtattcgcattgttggcgatcttagcaggttgcaacctgacgtt
ttagaaactgctctaaaggctgtggaaattacaaaacataacacaaaggcaacattaaat
gtttgctttccatacacttctcgacatgaaattgctacttctgtgcaatcaatagtaaaa
atggcagaagatggtacaatcactccagaagatatagatgaagatatatttgaaaaaaac
ctattgataaaagatagtcttcctttagacttgttgattcgcactagcggtgtggagcgt
ctatctgattttatgttatggcagtgtcacaaaaatacggagataaaattcatcgatttc
tactggccggatttttctatctggaagtttttcccaatgttaattcaataccagttacaa
aaccaaccagcataa

DBGET integrated database retrieval system