KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4F8.04
Entry
SPAC4F8.04        CDS       T00076                                 

Definition
(RefSeq) putative Brix domain-containing protein Rpf1
  KO
K14846  ribosome production factor 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPAC4F8.04
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    SPAC4F8.04
SSDB
Motif
Pfam: Brix Methyltransf_28 PI3K_P85_iSH2
Other DBs
NCBI-GeneID: 2543503
NCBI-ProteinID: NP_593868
PomBase: SPAC4F8.04
UniProt: O14180
Position
I:complement(2670529..2671449)
AA seq 306 aa
MGKIKNKIVRQQQYMKALHQKNKDKLERRKERAKEEEKDPEKKRLRLSENIPATIESKRV
YDETIIEDKPDEELQAELKDDEFSAYFSEERKVPKLLVTTSKRASRKCYDFASELLDCFP
NAEFRKRTGDIEVHEIAEAAAKRGYTDLLVLNEDRKKTNALTLVHLPNGPSFYFTLSNLQ
TAKEISNHGRSTGHIPELIINNFSTRLGMTVARAFQSLFIQTPQIQGRQVVTIHCQRDFL
FFRRHRYAFREKSNMPDGIGTGLQELGPRFTMRLRMVQKGVWDRKEGEVFFESNAGEESD
RRKFWL
NT seq 921 nt   +upstreamnt  +downstreamnt
atggggaagattaaaaacaaaattgtccgccaacagcagtatatgaaggctcttcatcaa
aaaaataaggacaagcttgaaagaagaaaagaacgtgctaaagaagaagaaaaagacccg
gaaaagaagagattgcgactttcagaaaatattcccgctactattgaatcgaaacgagtt
tatgatgaaactatcatagaggataaacccgatgaggaacttcaggcggagttaaaagat
gatgagttttctgcatactttagtgaagaaaggaaagttccgaaacttttggtaaccacg
agtaaacgagcctctagaaaatgctatgattttgcatctgagcttttagattgttttcct
aatgctgaatttcgaaaaagaaccggagatattgaagttcatgaaatcgcagaagccgct
gctaagcgtggttacaccgatttactggtattaaatgaggatcgtaaaaaaacaaatgca
ttaacccttgtacacttaccgaatggcccttcgttctattttaccttatcgaatctccaa
acagcaaaggaaatttcaaatcatggccgctccactggtcatattccagaactgataatc
aacaatttctcaacgagacttggtatgactgttgctcgagcctttcaatcattatttatt
caaacgcctcaaattcaagggcgacaagttgttaccatccattgtcaaagagattttctt
ttttttcgaagacaccgttatgcatttcgtgaaaaatcgaatatgccagatggtattgga
actgggctacaagaattaggtcctcgatttaccatgcgtcttcgtatggttcaaaaagga
gtatgggataggaaagaaggggaggttttcttcgagagcaatgccggtgaagaatcagat
agacgtaaattctggctttaa

DBGET integrated database retrieval system