KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4F8.07c
Entry
SPAC4F8.07c       CDS       T00076                                 

Gene name
hxk2
Definition
(RefSeq) hexokinase 2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00010  Glycolysis / Gluconeogenesis
spo00051  Fructose and mannose metabolism
spo00052  Galactose metabolism
spo00500  Starch and sucrose metabolism
spo00520  Amino sugar and nucleotide sugar metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01200  Carbon metabolism
Module
spo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
spo_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPAC4F8.07c (hxk2)
   00051 Fructose and mannose metabolism
    SPAC4F8.07c (hxk2)
   00052 Galactose metabolism
    SPAC4F8.07c (hxk2)
   00500 Starch and sucrose metabolism
    SPAC4F8.07c (hxk2)
   00520 Amino sugar and nucleotide sugar metabolism
    SPAC4F8.07c (hxk2)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SPAC4F8.07c (hxk2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC4F8.07c (hxk2)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     SPAC4F8.07c (hxk2)
Membrane trafficking [BR:spo04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    SPAC4F8.07c (hxk2)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF1351
Other DBs
NCBI-GeneID: 2543607
NCBI-ProteinID: NP_593865
PomBase: SPAC4F8.07c
UniProt: P50521
Position
I:2665816..2667183
AA seq 455 aa
MEANFQQAVKKLVNDFEYPTESLREAVKEFDELRQKGLQKNGEVLAMAPAFISTLPTGAE
TGDFLALDFGGTNLRVCWIQLLGDGKYEMKHSKSVLPRECVRNESVKPIIDFMSDHVELF
IKEHFPSKFGCPEEEYLPMGFTFSYPANQVSITESYLLRWTKGLNIPEAINKDFAQFLTE
GFKARNLPIRIEAVINDTVGTLVTRAYTSKESDTFMGIIFGTGTNGAYVEQMNQIPKLAG
KCTGDHMLINMEWGATDFSCLHSTRYDLLLDHDTPNAGRQIFEKRVGGMYLGELFRRALF
HLIKVYNFNEGIFPPSITDAWSLETSVLSRMMVERSAENVRNVLSTFKFRFRSDEEALYL
WDAAHAIGRRAARMSAVPIASLYLSTGRAGKKSDVGVDGSLVEHYPHFVDMLREALRELI
GDNEKLISIGIAKDGSGIGAALCALQAVKEKKGLA
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggaggctaattttcaacaagctgttaaaaagttagtcaatgactttgaataccctacc
gagtccttgagagaggccgttaaggagtttgacgaattacgtcaaaagggtttacaaaag
aatggtgaggtgcttgctatggctcctgcctttatctctacccttcccaccggcgctgaa
actggtgacttcttggcccttgactttggtggtaccaacttgcgtgtttgttggatccaa
cttctcggtgacggcaagtatgagatgaagcacagcaagtccgtcttgccccgtgaatgc
gttcgtaacgagtctgttaagcccatcattgactttatgagtgaccatgttgagcttttc
atcaaggagcacttcccttccaagtttggctgccctgaggaggaataccttcctatgggt
ttcaccttttcttatcccgccaaccaagtttccatcaccgagagctacttgcttcgttgg
accaagggtcttaacattcctgaggccatcaacaaggactttgcccaatttttgactgaa
ggtttcaaggctcgtaaccttcctattagaatcgaggctgtcatcaacgataccgtcggt
actctcgttacccgtgcttatacttcaaaggagagcgacacctttatgggtatcattttc
ggaaccggtaccaacggtgcttacgtcgagcaaatgaaccaaattcccaagcttgctggc
aagtgtactggtgatcatatgcttatcaacatggaatggggagcaactgatttctcttgc
cttcactccactcgttatgatttacttcttgatcatgatactcccaatgctggtcgtcaa
atctttgagaagcgcgttggtggtatgtatctcggtgagcttttccgccgtgccttattc
cacttgatcaaggtttacaacttcaacgaaggtattttccctccttccattactgatgct
tggtctttggaaacttctgttctttccagaatgatggttgaacgttctgctgagaatgtt
cgtaacgttcttagtacattcaagttccgtttccgcagcgacgaagaggctttgtacctt
tgggatgctgctcatgcaattggccgtcgtgctgctcgtatgtctgccgttcccattgct
tctttgtatctttctaccggccgcgctggtaagaagagtgatgttggtgttgatggttct
ttagtcgaacactatcctcactttgttgacatgctccgtgaagccttgcgtgagcttatc
ggtgataacgaaaaattgatttccattggtattgccaaggatggcagtggtattggtgcc
gctctttgcgccctccaagctgttaaggaaaagaaaggcttggcctaa

DBGET integrated database retrieval system