KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4F8.14c
Entry
SPAC4F8.14c       CDS       T00076                                 

Gene name
hcs1
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00072  Synthesis and degradation of ketone bodies
spo00280  Valine, leucine and isoleucine degradation
spo00650  Butanoate metabolism
spo00900  Terpenoid backbone biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
Module
spo_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SPAC4F8.14c (hcs1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SPAC4F8.14c (hcs1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPAC4F8.14c (hcs1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPAC4F8.14c (hcs1)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     SPAC4F8.14c (hcs1)
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N
Other DBs
NCBI-GeneID: 2543141
NCBI-ProteinID: NP_001342835
PomBase: SPAC4F8.14c
Position
I:join(2643624..2643683,2643860..2645143)
AA seq 447 aa
MSFDRKDIGIKGLVLYTPNQYVEQAALEAHDGVSTGKYTIGLGLTKMAFVDDREDIYSFG
LTALSQLIKRYQIDISKIGRLEVGTETIIDKSKSVKSVLMQLFGDNHNVEGIDCVNACYG
GVNALFNTIDWIESSAWDGRDGIVVAGDIALYAKGNARPTGGAGCVALLVGPNAPIVFEP
GLRGTYMQHAYDFYKPDLTSEYPYVDGHFSLECYVKALDGAYANYNVRDVAKNGKSQGLG
LDRFDYCIFHAPTCKQVQKAYARLLYTDSAAEPSNPELEGVRELLSTLDAKKSLTDKALE
KGLMAITKERFNKRVSPSVYAPTNCGNMYTASIFSCLTALLSRVPADELKGKRVGAYSYG
SGLAASFFSFVVKGDVSEIAKKTNLVNDLDNRHCLTPTQYEEAIELRHQAHLKKNFTPKG
SIERLRSGTYYLTGIDDMFRRSYSVKP
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgtcctttgatagaaaagatattggtattaagggcctcgtgttgtacactcccaatcag
tatgttgaacaagctgccctcgaagcgcatgatggagtctctactggaaagtatactatt
ggcctcggcttgactaagatggcttttgtcgacgatcgtgaagacatttattcctttggt
cttaccgctctttctcaacttatcaagagataccaaattgatataagcaagattggtcgt
ttggaagttggaactgagactatcatcgataaatctaagtctgtcaaaagtgttttaatg
caactttttggggataaccacaatgtcgaaggtattgattgtgttaatgcctgttatggt
ggcgtgaacgctctttttaacacaatcgattggattgagtcttctgcttgggatggccgt
gatggtatagttgtcgctggtgatattgctctctatgccaagggcaatgctcgtcctacc
ggtggtgctggttgtgtcgcccttttggttggtcctaatgcccctattgtttttgaacct
ggtctacgtggtacttacatgcaacatgcttacgatttttacaaacccgatttgacgagt
gaatacccttacgttgatggccatttttctcttgaatgttatgttaaagctcttgatgga
gcatatgctaattacaatgttcgtgatgttgctaagaatggaaaaagtcaaggacttgga
ttggatcgttttgattattgcattttccacgctcctacttgcaaacaagtccaaaaagca
tatgcgcgtttattgtacaccgatagcgctgctgaaccatctaatcccgagttggaaggt
gtccgtgaacttcttagcaccctggatgctaagaaatcccttaccgacaaggctttagaa
aaaggtcttatggccataactaaagagcgttttaacaaacgagtttcccctagtgtctat
gcccctaccaactgtggtaatatgtacactgccagtattttctcttgtttaactgcatta
cttagccgtgtccccgctgatgaacttaaaggaaaacgcgtcggtgcttactcttatggt
tctggtttggctgcctcgtttttttcattcgttgtcaaaggcgacgtctctgaaattgcc
aagaaaactaacttggttaacgatttggataatcgtcattgtttaacccctacgcagtat
gaagaggctattgagctacgccatcaagcacacttgaaaaagaattttactcccaaagga
agcatcgaacgtcttcgttcaggtacttactaccttactggtattgatgacatgttccgc
cgtagctattcggtgaagccttaa

DBGET integrated database retrieval system