KEGG   Schizosaccharomyces pombe (fission yeast): SPAC4G9.03
Entry
SPAC4G9.03        CDS       T00076                                 
Symbol
adk1
Name
(RefSeq) adenylate kinase Adk1
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00230  Purine metabolism
spo00730  Thiamine metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01232  Nucleotide metabolism
spo01240  Biosynthesis of cofactors
Module
spo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPAC4G9.03 (adk1)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SPAC4G9.03 (adk1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC4G9.03 (adk1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     SPAC4G9.03 (adk1)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPAC4G9.03 (adk1)
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_18 AAA_33 Cytidylate_kin Hydin_ADK
Other DBs
NCBI-GeneID: 2542704
NCBI-ProteinID: NP_593685
PomBase: SPAC4G9.03
UniProt: P33075
Position
I:2255935..2256597
AA seq 220 aa
MAGMRLILVGPPGAGKGTQAPNIQKKYGIAHLATGDMLRSQVARQTELGKEAKKIMDQGG
LVSDDIVTGMIKDEILNNPECKNGFILDGFPRTVVQAEKLTALLDELKLDLNTVLELQVD
DELLVRRITGRLVHPGSGRSYHLEFNPPKVPMKDDVTGEPLIQRSDDNADALRKRLVTYH
EQTTPVVEFYKKKGKWAAVDAAQKPEQVWEQIVAILEKAE
NT seq 663 nt   +upstreamnt  +downstreamnt
atggctggcatgagacttattttagttggacctccaggtgctggaaaaggcactcaggcc
cccaacattcagaagaaatatggcatcgcccatcttgctactggtgacatgttgcgctct
caagtagctcgtcaaactgagctcggtaaagaagctaagaagatcatggatcagggtggt
cttgtcagcgatgacattgtcactggtatgatcaaggatgagatcctcaacaatcctgag
tgcaagaacggcttcatcctggacggtttcccccgtactgtcgtccaagctgaaaagctt
accgctcttcttgatgaactcaaacttgacttgaatactgtccttgagttacaagttgat
gatgaacttttggtcagacgtatcactggtcgtctcgtccatcccggatctggccgtagc
taccacttggaatttaatcctcctaaagttcctatgaaagacgatgttactggcgagcct
cttatccaacgttccgatgataacgccgatgctttgcgcaagcgtttggtcacttatcac
gaacaaactactcctgtcgttgagttttacaaaaagaagggtaaatgggctgctgttgat
gctgctcaaaaacctgagcaagtttgggagcagatcgttgctattcttgagaaggctgag
taa

DBGET integrated database retrieval system