KEGG   Schizosaccharomyces pombe (fission yeast): SPAC56E4.03Help
Entry
SPAC56E4.03       CDS       T00076                                 

Definition
(RefSeq) putative aromatic aminotransferase
  KO
K00838  aromatic amino acid aminotransferase I / 2-aminoadipate transaminase [EC:2.6.1.57 2.6.1.39 2.6.1.27 2.6.1.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00130  Ubiquinone and other terpenoid-quinone biosynthesis
spo00270  Cysteine and methionine metabolism
spo00300  Lysine biosynthesis
spo00350  Tyrosine metabolism
spo00360  Phenylalanine metabolism
spo00380  Tryptophan metabolism
spo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01130  Biosynthesis of antibiotics
spo01210  2-Oxocarboxylic acid metabolism
spo01230  Biosynthesis of amino acids
Module
spo_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
spo_M00030  Lysine biosynthesis, AAA pathway, 2-oxoglutarate => 2-aminoadipate => lysine
spo_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SPAC56E4.03
   00300 Lysine biosynthesis
    SPAC56E4.03
   00350 Tyrosine metabolism
    SPAC56E4.03
   00360 Phenylalanine metabolism
    SPAC56E4.03
   00380 Tryptophan metabolism
    SPAC56E4.03
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPAC56E4.03
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SPAC56E4.03
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPAC56E4.03
Enzymes [BR:spo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.5  tyrosine transaminase
     SPAC56E4.03
    2.6.1.27  tryptophan transaminase
     SPAC56E4.03
    2.6.1.39  2-aminoadipate transaminase
     SPAC56E4.03
    2.6.1.57  aromatic-amino-acid transaminase
     SPAC56E4.03
Amino acid related enzymes [BR:spo01007]
 Aminotransferase (transaminase)
  Class I
   SPAC56E4.03
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 2543350
NCBI-ProteinID: NP_593270
PomBase: SPAC56E4.03
UniProt: O14192
Position
I:1244051..1245475
Genome map
AA seq 474 aa AA seqDB search
MAAQPKDLSHHLSVESASRKQSPLKAVALSKSSRNIKIISLAGGLPNPEYFPIREMDAEI
PAINSWKKDSSNSGKLDTVSVPMSSSDSDVLPLSVALQYGQGSGAALLSQFLKEHTRIIH
NPPYEGWNIIMTTGNTSCLDIALRMLTNRGDSILVEKYSFPSALQSMRPLGLSCIPIDMD
QFGFLPESMDDILTNWDATSYGSPKPHVLYTIPTGQNPTGSTLSVERRKQIYTLAQKHDI
IILEDEPYYYLQMDAYEGKPEAADKAFTNEQFVKELIPSFLSMDVDGRVIRMDSLSKVVA
PGSRVGWFTAQPLFIERGLRAAETATQSASGISQGILYAMFKHWGQDGYLEWLKHIRYSY
TLRRNYLLYAMDTYLPKSVCSYIPPVAGMFIWFEVDKSRYIHADKNESIPEIESKIHAEA
VEEGVNLACGNWFVVDPRVNDKIFFRVTFAHAELEEFNVAIERFAGVLKNNFKC
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcaacctaaagacctttcacaccacttgtctgtggaaagtgcaagtcgtaaa
caatctccacttaaagctgtcgctctttccaaaagcagccgcaatattaaaatcatttct
ttggctggcggtttgcctaaccctgaatactttcccattcgtgagatggatgcggagatt
cctgctataaactcttggaagaaggattcttcaaacagtggaaagctcgataccgtttct
gttcctatgagctctagtgattctgatgtccttcctcttagtgtcgctttgcagtacggc
cagggttctggtgctgctttactttcccaatttttaaaggaacacactcgcatcattcat
aatcctccttatgaaggttggaacatcattatgactaccggtaatacttcatgcctagac
atcgctcttcgtatgttgaccaatcgaggcgattccattttggtagagaaatactccttc
ccttccgcattacaaagcatgcgtcctcttggtttaagctgcattcctattgatatggac
cagtttggttttttaccagagtctatggatgatattttgactaattgggatgctacttcc
tacggttctcctaaaccccacgtactttacactattcctactggtcaaaatcccactggt
agtactctttctgtggagaggagaaagcaaatttacactctggcacaaaagcatgatatt
attatcctagaggatgaaccttactattacttacaaatggacgcttatgaaggaaaacca
gaagctgctgataaagcttttaccaacgagcaatttgtaaaagaacttattccttcattc
ttaagtatggatgtcgacggtcgtgtcatccgtatggattctctgtcaaaggttgtagcc
cctggttctcgtgtaggttggttcactgctcaaccgttgttcattgaacgtggtttgcgt
gctgctgaaactgcaactcaaagtgcttctggtatttcccaaggcatcctgtatgccatg
ttcaagcattggggtcaagacggatacctagagtggttgaagcatattcggtattcttat
acgcttcgccgtaattatcttctttatgccatggacacatacttaccaaaatcggtctgc
tcttatatccctcctgtcgctggtatgtttatttggttcgaagttgacaaatcgcgctac
atccatgccgataaaaatgaatctattcccgaaatcgaatctaaaatccatgctgaagct
gttgaagaaggcgttaaccttgcttgcggtaactggttcgttgttgaccctagagtcaac
gataagattttcttccgtgtgacatttgctcacgctgaattagaagaatttaatgttgcc
attgaacgttttgcgggcgttttgaagaataatttcaaatgctga

DBGET integrated database retrieval system