KEGG   Schizosaccharomyces pombe (fission yeast): SPAC56E4.06cHelp
Entry
SPAC56E4.06c      CDS       T00076                                 

Gene name
ggt2
Definition
(RefSeq) gamma-glutamyltranspeptidase Ggt2
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00430  Taurine and hypotaurine metabolism
spo00460  Cyanoamino acid metabolism
spo00480  Glutathione metabolism
spo00590  Arachidonic acid metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SPAC56E4.06c (ggt2)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SPAC56E4.06c (ggt2)
   00460 Cyanoamino acid metabolism
    SPAC56E4.06c (ggt2)
   00480 Glutathione metabolism
    SPAC56E4.06c (ggt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spo01002]
    SPAC56E4.06c (ggt2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:spo04090]
    SPAC56E4.06c (ggt2)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     SPAC56E4.06c (ggt2)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     SPAC56E4.06c (ggt2)
    3.4.19.14  leukotriene-C4 hydrolase
     SPAC56E4.06c (ggt2)
Peptidases and inhibitors [BR:spo01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   SPAC56E4.06c (ggt2)
CD molecules [BR:spo04090]
 Proteins
  SPAC56E4.06c (ggt2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 2543110
NCBI-ProteinID: NP_593273
PomBase: SPAC56E4.06c
UniProt: O14194
Position
I:complement(1256566..1258401)
Genome map
AA seq 611 aa AA seqDB search
MSPTDTTPLLYSWDDQSRHQDPDWHKLRNYHGAWYRRISRRRFSQFIFAFGLMTLFVLVY
SISSNLHTPTQFTGHKVRGRRGAVASEVPVCSDIGVSMLADGGNAVDAAIASTFCIGVVN
FFSSGIGGGGFMLIKHPNETAQSLTFREIAPGNVSKHMFDKNPMLAQVGPLSIAIPGELA
GLYEAWKSHGLLDWSKLLEPNVKLAREGFPVTRAMERVLKLPEMAHLLKDPIWQPILMPN
GKVLRAGDKMFRPAYAKTLEIIANKGIEPFYRGELTNSMVKFIQDNGGIVTVEDFGNYST
VFADALHTSYRGHDVYTCTLPTSGPALIEGLNILDGYPLNTPSLAFPKRLHLEVEAMKWL
SAGRTQFGDPDFLPLDHLDVVSKLLSKEFASQIRNNISLSKTYPWEHYNPSYDLPISHGT
THVSTVDSNNLAVSITSTVNLLFGSQLMDPVTGVVFNDQMDDFSIPGASNAFNLSPSPWN
FIEPFKRPQSSSAPTILTDINGDFEMALGASGGSRIVTAVLDSIIKRIDMDYDIESMVAS
ARPHHQLLPDILILESGFSKSVATRMKKYGHKVWRLKQHDTPLSQIQAVTRHHSEYYGMS
DPRKYGQAAAY
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagccctacagacactaccccattgctgtattcatgggacgatcaatcaagacatcaa
gaccccgattggcataagctccgtaattatcatggtgcgtggtatcggaggatctcaaga
cggcggttcagccaatttatttttgcttttggactgatgactctgtttgttttagtgtat
tcaatcagttccaatttgcatactccaacacaattcacaggtcataaagttagaggaagg
cgaggtgccgttgcctcagaagtgcctgtttgctctgacatcggtgtgagcatgcttgca
gacggtggtaatgcagtagatgctgccatagcatccactttttgcattggagttgttaat
ttcttctcgagtggaattggtggaggtggtttcatgttaatcaaacatcccaacgaaacc
gcgcagtccttgacgtttcgcgaaatagctcctggaaatgtgagtaaacatatgttcgat
aaaaatccgatgcttgctcaagttgggcccctttccattgctattcctggtgaattagct
ggcctctacgaggcttggaagagtcatggtctgctcgattggtcgaaattgctggaaccc
aatgttaaacttgctagagaaggatttcctgtgactcgagcaatggaaagagttttgaaa
ttgccagaaatggcccatcttcttaaagatccaatttggcagcctatccttatgccaaat
gggaaagtacttagggctggcgataaaatgtttcgtccggcatatgctaagactttggaa
ataattgccaataaaggtattgaacccttttataggggtgagttaactaattctatggta
aagtttattcaggacaatggtggaattgttacggtcgaagatttcggaaattattcaacg
gttttcgcggatgctctgcatacatcctacagaggccatgatgtgtatacatgcaccctg
ccgacgagtggacctgctttaattgagggcctcaacattcttgatggttatcctttaaac
acaccttctttagcatttcctaagcgtctccatttagaagttgaagcaatgaaatggctt
tctgcaggcagaactcaattcggtgatccagattttttacctcttgatcatttggatgtt
gtatcaaaattgctctctaaagagtttgcgtctcaaattcgcaataacatctcccttagt
aaaacatacccttgggaacattacaatccttcttacgatcttcctataagtcatggtacc
acccacgtttccactgtggacagcaacaacttggcagtttcaataacctctactgtaaat
ctccttttcggctcacaattgatggatccagttacaggtgttgtctttaacgatcaaatg
gacgatttttccataccaggtgcttctaatgcatttaacttgtccccttctccttggaac
tttattgagccatttaagcggcctcagtcttcttcagcaccaaccatccttaccgatata
aatggagattttgagatggctctgggtgctagcggtggtagccgtattgtcaccgctgtc
cttgactccatcataaagcgaattgacatggactatgatatagaatcgatggttgccagt
gctcgtcctcatcatcaattattacctgatattttaatccttgaatcaggcttctccaaa
tcagttgctactcgtatgaaaaaatacggtcataaagtctggcgactgaagcagcatgac
acaccgttgagtcaaattcaagccgttacaaggcatcacagtgagtattacggaatgagt
gatcctaggaagtacggtcaggctgccgcttattaa

DBGET integrated database retrieval system