KEGG   Schizosaccharomyces pombe (fission yeast): SPAC56F8.05c
Entry
SPAC56F8.05c      CDS       T00076                                 

Gene name
mug64
Definition
(RefSeq) putative BAR domain-containing protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: BAR_2 BAR Radial_spoke DUF2564
Other DBs
NCBI-GeneID: 2543229
NCBI-ProteinID: NP_593220
PomBase: SPAC56F8.05c
UniProt: Q10253
Position
I:complement(join(1134697..1135061,1135195..1135402,1135517..1135684,1135729..1135776,1135932..1136003))
AA seq 286 aa
METFKTHITGQFNATVSSITPFAKKTTHYLRTKIGSRVEELSLPEDYVELEQQVDSLKEA
YNLVLPIVETVEVDGYDYPTNFRDSITDFGKTVSGKVRNLGNLTPLEQTPLASVGKNLEE
KEAAAKPSRTLYNAISRAASEATTKMGAGNPLSSAFGQISVLEEKVGNLQGERDSAISKN
FCEQVRAVLYPRFAEAHRVKADVQDKRLQLEMAKLDVESAKPENLEHCKSAVRSAEDELN
GAIEHAKILYEQILNKDYNTDLLRSIIKNQLKFHQDAAAALSDITI
NT seq 861 nt   +upstreamnt  +downstreamnt
atggagactttcaaaactcacatcactgggcagtttaatgctacagtttcttcaatcacg
cccttcgctaagaaaaccactcattatttgcgtacaaaaattggatcaagagtcgaggaa
ttatctcttccggaggattatgtggaattggaacaacaagttgatagcttgaaagaagca
tacaatcttgttttacctattgttgaaaccgtagaagttgatggatacgattatcctaca
aatttccgcgattctattacggattttggtaaaaccgtttcgggaaaggttagaaatctc
ggaaatttgactcccttagaacaaacgcctttagcttcagtgggaaaaaatttagaagaa
aaagaggcagccgcgaagccctcaagaactctttacaatgctatttcccgtgctgcttca
gaagctacgactaagatgggggctggaaatcctctatcaagtgcctttggtcaaatctcc
gttttagaggaaaaagttggaaatttacaaggggagcgcgattcagctattagcaagaac
ttttgtgaacaagttcgtgcagtcctttatcctcgttttgcggaagctcatagggtcaag
gctgacgtacaagacaagcgtcttcagttggaaatggccaagttggatgttgagtccgca
aaacctgaaaatcttgagcactgtaaatcagccgttcgttcggctgaggatgaattaaac
ggtgccattgaacatgctaaaatactttacgaacaaatcctcaataaggattacaatacc
gatttgcttcgtagtattataaaaaatcaactaaaattccaccaggatgcagcagcagct
ctatcggatataaccatctaa

DBGET integrated database retrieval system